SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|115688|au.87_g16790 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|115688|au.87_g16790
Domain Number 1 Region: 1426-1541
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-18
Family C-type lectin domain 0.0027
Further Details:      
 
Domain Number 2 Region: 288-342
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000497
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 3 Region: 173-227
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000288
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 
Domain Number 4 Region: 386-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000318
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 354-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000103
Family EGF-type module 0.051
Further Details:      
 
Domain Number 6 Region: 1171-1238
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000165
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 230-284
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000222
Family TSP-1 type 1 repeat 0.009
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|115688|au.87_g16790
Domain Number - Region: 759-912
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000214
Family Clostridium neurotoxins, the second last domain 0.044
Further Details:      
 
Domain Number - Region: 393-505
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000879
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 953-1074
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0113
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|115688|au.87_g16790
Sequence length 1544
Sequence
MTLRALEWEIRSIKQNLSATLDELRSLNTSVSSLPQLPWGNLTSSVVRCSLPYNWSQIIN
KEEEGRVQIGGLGHLMQIDKYEVWVCDYDNRCVQQEGDALCFVFDEVKEIFLPWGLDSEL
LLTQQGPFQPDLAISNILAKLKVLEQEIRSGGCGGSCMTSQQVQQLLDQYYLEPGYLWSA
GSFSQCSSLCGSGVAKRSITCISKLLEQVEDFRCSNRSKPFAEVPCANYSQCSFEWEVGA
YSECLTGCGQGSRRRSVSCRRSDGVVVEIVKCLGSAPVQEEPCSNFSFCSYRWASSSWEA
CSSTCGSGLQYRSVMCVRSDGVEVEDGMCETGSKPRIFQACTGASGCNYTLMNECAMNTD
NCATHASCFDTYASFECSCQPGYVGSGTVCEDENECVKRTGLCDATTMCVNTEGSFQCLC
KEGFYLDVTSPSSSCVACSAGLYTSGLGQTSCSLCAPSYYGSADSGCNPCPAGSSSAFGS
QLVTDCKCQFGFSGSISNAGDSCKPIFSNVEEQTRWLRLGASGMSCTATCAAEGKTCVSS
AINQIDDEEAIRSAVKAASIASDRRIRAAMTEPQKRPEGLHFRMSAGARKPEDDGLQDLT
ANSGHVRRQRYVEYGATSFPLVPKAESICCSITQEFYVDLPVELSSSRMIDISVTVEGSS
SGDNTEAFSLVDLSGWRGACMSDVPQIEDPMMWSRIPLQSLNCRIRAPLQEALADGGGQI
GPIAISYSSISYNGRSTWRISVGQLEDETEEPLRPMSDGKLKYVNGSFQDVVTFPPMSIP
GPFFTLCSISRYNDNFRNRILQAAEANFYHGHRNGGREQASYNGTWNLAQDLSPTAEAWV
VLCGQNYQEGKFFLNGVEYQQSAASLSSSLQLTINYNTWDFYHRFFLESSDWALSEVAIW
QGALREDELRAVSSHLMHMLSDGSDVLYNQTLNVSCDKVFPALNGFAPFVSASECFFPAK
GYHSTCDASFNGASRVCVCSAPCLENFYGHADACIRCPFYSLSPPGSSSIHDCSCDQGLM
SPFASSSVEDCMCKPGSYGSAGNCSSCPALSTSTPGSTSIEDCFCLAGFGVKATGYSRQV
TSPTDKCEAIVDEMFLAESVGMSCSEVCASKSLVCMDEAQPLLSNADLRSLSTFFSVPFT
GEIVGTSNLDAPSYNHETGQAFLRYGSRGSCSATSSTNVRICRCTCADNQYGNTGSCLSC
PANSSSSWQAQGRSSCICDSGYFFNASQECSPCSSGTYAKRMKMADQDFGRNGTMGWKGT
EQITSCGRYGSVLGGLNELAEYSRVGKTFTGLCPHGFLYIRMQVLLIDFAQPVMVRLFVN
RQEVWNQTISAISPSSTSECGQSQGDAMINPSMRLYHTEGYVEAEVQVDYVYWESSVKTF
WGLKDFSVVVPCASSSASDCSMTSPLTQTCSEVTESGVPCMQSGVYLYVYYPDTWMNFSD
AEAKCNQIGGGGGQVAYFPDGQTHDEVIAGLGISSDNWIGLQHSAGPQYDFKWVTNGPPS
FTRWADGGPNDGNWNDLCVLLRDSLWYDVPCSSTYRVLCSYLAV
Download sequence
Identical sequences L1IQN7
jgi|Guith1|115688|au.87_g16790 XP_005825115.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]