SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|118616|au.131_g19718 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Guith1|118616|au.131_g19718
Domain Number - Region: 114-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00364
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|118616|au.131_g19718
Sequence length 405
Sequence
MNLADTTNDCKKTVYYEACIPALFGQGCTRFPVTGPCESQFCPRNCTGHGHCEERNLEAS
CACEAGYTGHYCATQLCPADCSGHGRCHALDGTCDCDKGFGGLDCSQVQCPDNCTHPNGV
CDLKTGICTCQTGYSGIDCSHEPKKLYNESWGVVFALSLVGICTIFIYMINLSRFKFLPD
SISAIMIGAIVGLMIRIMGVDNKHFIFIRANSIFLFFLPLILFESGYCLKKASFFRNFPT
ILVFAVFGTIISAMVVGAGTFWLGQQGLVYKLSFLNSIIYGALLASTDPVATLAIFQALK
VDHTLYMLAFGESVINDAVSIVLFESILSQYYINQEHHSMAHFPVQFVFTFTASIVIGVT
CALFAALTFKHLHLRELSSSPIEISLMLVFSYMPYLLAASMRLVR
Download sequence
Identical sequences L1IH71
XP_005822155.1.50599 jgi|Guith1|118616|au.131_g19718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]