SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|120407|au.181_g21509 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Guith1|120407|au.181_g21509
Domain Number - Region: 264-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000145
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|120407|au.181_g21509
Sequence length 438
Sequence
MGESSSMLASSANMTRAKSAVWRGVAQDAEADLDVKTGCLVLDGKSMHEFGSELPFLHVS
MAHCMEEVDRSGGQVKLMTRLDGEDLRSYDFQPQPLLITLPLLLAGPHEFAVSLRAMEED
GSMRDEDAIDEQFFLFFTCDFRPRLNWVFPPAGYVFKRNSQRFLRFTVDDVGDPSRCQEG
STSCSGYEPMAYHVSYYVNGEKMGERMRSVYFLGLSFLPDGHHTAYVEVSDKHNQPLGIN
HSVSFSIASDEEYLEDGEMAEVETPCPETRCPNDCGEMGRRSESHCVCAPDWTGERCEHH
LLSHLAYLPTSDPHMAGDRCVKSKVWEEMAEELRVRLEQLQHATDHRQCRNSSRISVVRI
RGTNGHTGFASFVEQVENLAIDAPDASPVRNPTAIQDRWSTGGSFPQRHDALQQEDLSCY
FQPLFSVLKTSAGMIAQR
Download sequence
Identical sequences L1IB09
XP_005820383.1.50599 jgi|Guith1|120407|au.181_g21509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]