SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|120648|au.191_g21750 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Guith1|120648|au.191_g21750
Domain Number - Region: 286-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00293
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|120648|au.191_g21750
Sequence length 711
Sequence
MSQCKVNQQRRLIMVVVIFMIPVFHARQTTNGETSCYHVLFPPQQYLLQKDDPSHITVSI
GSCPSSLVGNRVIVFLNSVLVHEQDIVDEDMVLDAIAITRVVLGWNEIRVSSSAPNLPHI
SSQFFVSVDYLQTSFSELVINQATYLPETSAWPWFVNDKPFFLHHAKLAAMKPLVKIVWP
PAGYTFKRMHYGPTAFSPFLRVEMLPGFGFNLAMSIDEEPMKVYGPVYFLNLLLADGEHV
VRVALTTPDSQHMISEVQTVFFTVNQTIEYEEDGEGADGSEGLLSLDPFECSSLAKDGCQ
TCVRGKCLDGFCSCFPDYFGESCEYSFLSDTRYLPAKDPSKVWDFSSCNKFIQAERLSQA
MGEKLNSMQFQQTPTPVSETSRRILRLSLDDTSGFGVTLHLISQIFSYAIRNNESVIMTG
KFSYFRHRACRTPGQREDLTCLFEPTQDRSFDHLNISLIPPTFTANYQLHNDWHLPLHVN
ASGGGIFFFISQLSRFLMTPNRNLEALLRRVKRRIRYQHPIIGLHVRHGDSCPKWEDKHS
HLPGAKCEKLERYVEEIREMKRRYGVTRVFVCTDDPAVIEQLALLTDFHFVFVPFDRKLF
SASDWAIELKLLMATLDRRLAAESTVLDILLLAEADYFVGTLSSHFSSLAFELSVANKGF
VPPYVSLDFAWHGSLLAPVQYYNDEGETVEAREHNPARRDPTPRTAPTTKS
Download sequence
Identical sequences L1IAB0
XP_005820148.1.50599 jgi|Guith1|120648|au.191_g21750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]