SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|135847|fgenesh2_pg.17_#_104 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|135847|fgenesh2_pg.17_#_104
Domain Number 1 Region: 232-334
Classification Level Classification E-value
Superfamily C-type lectin-like 1.41e-25
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 2 Region: 752-907
Classification Level Classification E-value
Superfamily TPR-like 1.64e-21
Family Tetratricopeptide repeat (TPR) 0.0027
Further Details:      
 
Domain Number 3 Region: 404-532
Classification Level Classification E-value
Superfamily C-type lectin-like 3.44e-18
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 4 Region: 1017-1153
Classification Level Classification E-value
Superfamily TPR-like 0.00000023
Family Tetratricopeptide repeat (TPR) 0.057
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|135847|fgenesh2_pg.17_#_104
Domain Number - Region: 197-223
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0306
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 367-393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0894
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|135847|fgenesh2_pg.17_#_104
Sequence length 1264
Sequence
MGRERYAQDGVAFLRLLLLLSSVWSCVGQQVKTRNLKGPASQPWKCKPVKIQGNWHGHYL
HDTTFVKWECEMTSSVQQVYQATVNYRPSSEMFMDVNNVFGVAKSRTSTGTVIFLGMFDK
VDDCELACFRYSSGGAKCNAYSWHRPAFGSHEWRRQCFAVVDGHWVPHQQKGVVSGRVVR
HSTSMQDADGRGCVDRCSGHGVCQNTTGTCICDTGFSGFDCSVEVACDSATVGGRCYTVF
EKKTSWKKAQEKCKLGGGTLAILQSKEQQNALLGVFGGCNSAWIGLNDMKEEGSYVWQDG
PRATWFNWAKNEPNNKGNEDVVLLRKDTKQWYDSAGKAGMADCYACSYKEGQSSAHGEEA
SSCARDCSGHGVCGAVTGMCTCEEGYFGADCSKKTPCEGFTLDQMCFVVYPEAGSRTKAE
EKCRSRGGQLSGVYSHQHEQKLLQLGRAKGCRMQEMWIGLNDQEREGSWEWSSREMSDVD
YVNWLPWEPNNGAAEIGGLSQEEEDGVVMDKFGWTDVNIARSNISCFACEFAGTGLHEAS
SALSRHGEKALDSPVLFNFFAPDLDPVLRRVSCPPGVGECVDDEEVGDAEPFVCSAHDPN
YIDEEEAEAEEEEEGAEAEGQEGDEQTLEEVVQEEEDATNIPPAAVVELPPSKCRGPLPL
MNTTAERCWRSCFKVQERFGEAAGDNCRQMCVRLAGLINEDMVLVAAGEGQDVLDFYAGV
NISDPSKVGTQGSEEEKQVRTEALVNNVWAAAVHVGQHEKAERAITKLLQAHPNFLMLHY
TLGVALMTQGRLQEAKSCFRRCMDSGAVKAQCLTSMGNILLKQGHVEEATRVFLLGTSSF
PNYPPLFSGLAAARLQRSNPEEAFASALRAVRLRPSVVHYRLQAALAARRSGNSTAAIEI
LQEGLKQPGGRDEAALHVVIAEVAEGMVEELQNRRSLRYLEANLCSDRCAWQQGNSSLHG
GRIPLFSESARMALRSYRLAIRSLRRLRDEAERCEETFGNETVMKCGRAPPLVEILRLRA
LMANLLGKLGGWEESLAIHSQILAQRAGFVPSLLGKASAAANLQQHKVVGEAIEIAMQQG
MQMNQAPSETRVLYGNALLEHARSLIQEGKLRESLPLLRTAMKVDSSRTLPYAVDAWRLL
CRVYYKLKHPEPATYACSWSVKLSPQAVEPRQALQWAEEETKELRRQREFRERARQREQK
EKRKAEEAKKKVEEDKWKYQFGDGSWREGKGGGRGNKKGKQGKSPSQTKKRVVRHPRAQA
LLHA
Download sequence
Identical sequences L1JNA8
XP_005836655.1.50599 jgi|Guith1|135847|fgenesh2_pg.17_#_104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]