SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|136216|fgenesh2_pg.19_#_60 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|136216|fgenesh2_pg.19_#_60
Domain Number 1 Region: 341-379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000599
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|136216|fgenesh2_pg.19_#_60
Sequence length 559
Sequence
MSVSQTAPVRQGRLLQRATWLLVLVLHALSFAFCHGCSVLISAEPHHDCQERTWVLEGGV
KGHWSQGIDILVFECEMVNLVLMASGCEAAEQQPVKVRIDTGEHFIHRGSYTSSEQPSFR
LEIPGVSESGIDVPLLHLADGMYNLTAHFGHPLHLAASTMFAKLSPHVNPALEVMFPPQR
YTFGNDMEPFLQVYVQDRDASIAASGTTAGASKQLAFYLNITIRRLEGEEVVEEKTVMEW
SPNSRKIFLGRHMEASGTYKIEMVIYDAVLRPTDAREEVLVMISHSSRSPLACIAGEPEC
TPQATDRTGEEWFQGGNHSTFLDRLVDAVQSHCPQISPQDRHCRDKEQDACSGHGWCLDS
FCYCYQDYAGPKCDTHLLSALQYLPSSYPTQDVSHCHQSIALSRGMEGLSRTYNALQNPA
VCDDSKSIQRRFNKTQGLGVTFRWLSLSLLLSLAEQKTLLIGGKWRAFNFEGCSDRGLWC
YLLPSSNCSVSSWRWEEISEKDFYMPQVLVVPSEGIDQGQLWWSSQMTHLIMRPSVDLKE
KVRRIKVKEEEEEEEEEED
Download sequence
Identical sequences L1JKK2
XP_005836011.1.50599 jgi|Guith1|136216|fgenesh2_pg.19_#_60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]