SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|139518|fgenesh2_pg.39_#_1 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Guith1|139518|fgenesh2_pg.39_#_1
Domain Number - Region: 147-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number - Region: 228-255
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number - Region: 66-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.053
Family Integrin beta EGF-like domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|139518|fgenesh2_pg.39_#_1
Sequence length 305
Sequence
MSTSNRNETENDICRQTTFGFDCNIFCDSYTNCSAHGRCATGYTGHNCSIETSEVGRPGG
YCSSAADCGGKERGECREGRCECKGGFGGRTCSPCREDQYGASCEAGCTVDGNCSGHGRC
ATGYTGHNCSIETSEVGRPGGYCSSAADCGGEERGECREGRCECKGGFGGRTCSPCREDQ
YGASCEAGCTVDGNCSGHGRCATGYTGHNCSIETSEVGRPGGYCSSAADCGGEERGECRE
GRCECKGGFGGRTCSPCREDQYGASCEAGCTVDGNCSGHGRCATGYTGHNCSIETSEMRY
GIHGP
Download sequence
Identical sequences L1J896
jgi|Guith1|139518|fgenesh2_pg.39_#_1 XP_005831547.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]