SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|140920|fgenesh2_pg.50_#_14 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|140920|fgenesh2_pg.50_#_14
Domain Number 1 Region: 725-775,805-893
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000149
Family Fibronectin type III 0.0065
Further Details:      
 
Domain Number 2 Region: 4726-4877
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000004
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 3 Region: 1010-1124
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000124
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 4 Region: 4921-5006,5233-5259
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000204
Family Growth factor receptor domain 0.018
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|140920|fgenesh2_pg.50_#_14
Domain Number - Region: 163-218
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000102
Family Hairpin loop containing domain 0.043
Further Details:      
 
Domain Number - Region: 4866-4906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000105
Family EGF-type module 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|140920|fgenesh2_pg.50_#_14
Sequence length 5421
Sequence
MEFRHLILFAVLACYLCQGYASKGAQQLSDVAEDKSSYEIRTNDIVIKPILGWCVDYGQN
KSSNVSNASSSISYIDSCDKNYRQKGNYGQLQCEDPFFGGLFGCCYIQAYDSCTSCRYST
LTCIDAAKQCAQRWTNQIETQQGYIPTYTSRTQTCVNNSKTGNGYWYQPGFTFYGSFTNA
ASKFYVFPTPEQCAAECDKIQGCTAFMYSVNSQICIHLLAKVEGMCDLSTTECLNNPLRP
PTKFDYASSNSALCNNCLLYILDIDRMYCAPNSNTCAGAREYYQCMQSWGCANSAADLSA
HREVCRSSGCTAVQCGLSTVDCNTTAIVCAQTFSTCMLESQGSCTCTKSFLQCMTDANCN
VKVASSASGYTAESMCVLEGCTAEECGLNTASCNTTSMRCASDFYHCSENVYGNITVELA
TSSPDCGVIRSFMIHRLVILPMTITVDSDRTFLYEHCVLDGCPDSDCGFLPGVKNVFCSS
LEMSDICMTNGCTPDECGVCGRKCSYLAAQCNNQYIQCEFSGANKCDCAKNQYECLNTAG
CVSDATWIQKHAQLCADFGCTALECGLPSTYTSCNQTGFKCVGKLRSCLESTIDFSNDVC
YSHYLTKLDMGQRGRDVCNNPWAGGLPGCIYNEATGMCYLKVNCACSKSYVECVETGGCA
DTSSMQSYAQLCAYEGFCLRNYYTCLTSSGCTKPSYLKLNREICQKEQCSLEECGIIGNA
ESPVVPGPPEYVSLQSLPSRSMGIAWQDSEQAQQWAISGSRNYVVQYEVLIEGSCSGVVV
QQSGSIDYNLMSCTQSLYHKNISARTKGFVFQGSLVKGTIYRVSVWAINLAGKGSSPRVN
ATRFTGPPGQPPTPAISNRNSLTVRMTWSRPSDTGDTTSQKSLKAYLLQIFANPSVYYGN
NITTAESIVSYDFNTAVGGTFTKCANQGQICYCEGVVRYGADGQWSVPYIAPGWVNCTDG
DIFPIVIWNAAHICECNSRADKLLGTLPEPIMAGQSVRGRLLAINDIDEGPFSEFASVRA
MSKPGPVRDMSVTAASDGFLISWNAPSDYGYGLGVFENILLDYSIKLSTCPEVNSGSTCT
VQQFSKSPDCNGLCTYKIPELNTLLEGTVYYILVQAQNSAGIGFMDLKSFVRKAWKLRAY
ISYPADQKFPLRVAQWDGQSYVWIDGNVQNNIAITVENLPLAPSTTYLPINVTLGSRSVI
SQLFVSSRTILSHVSTGSSNCGDQAASVQYSYPVSGLLNFFQATSSTLQVYFNSSMGTVT
DITPDVEGTLRITARTPLLATQGVAIISFYLQGSRLPLTTDPIFNFRKQYIASVVPGYGL
SSGGTAISVLAIGLLETVSSVQMYLNNVECLAVSFSQNSDKLTVAGNTPSSSSAGYVVVK
LVINYQTGSVPSTLELANGFRYLSVPQLQLPDNFIQVLNQTAASIGIDITKSTIVKFRVS
NLPTQTGSFQVTVGQELATVISYTECTDLFSCQVEIQISTPTTLDAGSYSITVTAFNSIY
QNQQSSVTSTLKLNFVDYAKPFLISMSPTVSRLQGGAMIVCGFTIPEGSISITVNIGNTK
VDDNKVSFLKYSDWLVPNLQEQFLGTDFISNFLSGASQEDVTVINSTIAQLSQLQMGSAI
LFFRSRSATTTGLFDVTINLGQPSYNLYKTLQYLPDPTGDVQADFIPVRGLPYTKVQVTL
KNFQLVYSVTELNVTMSAQQLPTSDLTLLKSDSTSTKMSLTVPNILPGLRTINISNIVLP
SLVASFAFTVVDPNPPAIQSQTTENVYTDGLDSITVTILNFGDATVVKSDLTIQIQSSSS
ATSTSTIVQTYSISYDSNLQLSTVTFQAPPFAPGSAVVSLSIVRLADAISFNIQYVAIPT
GDPVMTVQPSQGKDTGNVPVTCLLTNFRRISGASDLKVSFGSVVLSSSQLTVSSSFETTI
VSFLTPDVSATSPTQVTISVYAIGRESQVGSASFSVTNTLRTTLNFVDPPQVVFATTQDT
KVVMVSLSNVGTAGLTANDFDIVKTVSSMDVPGLTATIQQVLQSTTKLTDFDILLTAPTI
PYNQSFDVSFVISYKNDGTLLAVKSVTFTVQILPNDKMYISSFDPTSYFTDGKVSMKVTV
QNLPSSITSQSASVFLIYFGNTMTTATSATFTQSSTANKYTGQIKLRIPTVLDPSTVKPT
LKINITGDVIEFPSSFSYVKAPNPDITSLKPAQGFTNTETEIEVTINQFAAIENGLSDII
ATITELSCQLISYSQVNPTLDKSLIQGYKIRLRTPCCVPEIVAGYATVFLAHRDFPNRYA
LASGSNGFQYIDASAPRVSSVVGDLSGAFVKKYSTTPVTVTIEQIFQTFSSVSATLMGVE
VPVLDFSGDFNTGQATVRLLIPSSNQYDTATGEITFPSGLTASYTVTYYDELLPSILKAL
PTSGTICGGFVVTVQISLFPVLNQKQDVLINIGDSIFVLSDNVQLVSSYSSQTDLQYLSP
AVSQGVYYVKLTPFQFPRKYVEFLFNYLTASVFLKSISSTQVQTTGGQTINIVISNFPVV
TVSSEILVYLGSTPAQNISLVSSVCSETIVSFVVPPLPSAGNVSGTMYPRRLGTAGAVGF
SVLAVNPVALQIVTPTPTEICACTTCTNVVQYVYVKNLDPNAVSSVFYTKNLPFVVTKYD
NTTLLTILQVTITEAIKVISSDNIVVTSGSLTATAAFRVIDCTVPRLVSISKSTSLNTGG
SNIILTISNFKPFNYNLPVTVNFGGTVVQVQNTDIWSADGADITSASSIALAKISVTVPA
VSIFWSIVASVYQNSVKIVDFDFEFQAPCDYDEACGSKFPDLLKIQALADSATCNLQFCL
DRSQVPTPFLSVVEPTTGLTSGGTSVRAILFGFPALSQQDVTIMVGSASFPSYAKIVGFK
YLTSDGLNSNVEMNFTMPQAPMGATSTDVQLSFAYGRLTKSTSFSFLYKTPLSGPALILF
ASPKQAFTNEQSLSFKVEIGNIPVVPAPLTSQDALSKLYLSIDGVANSLITATSIIKSDA
TSTLCTFQVSAVPQAGNYNISVGYSLFPTTRAGRFPFTLSVYPEPVARSIYPLEMRKGTT
TSFQAAICYLGTLAPTVSSTTSVQPQGATVLSTDSADPSCPLSNVQFSLTLPTSESALST
TFRVCAGSGPTAKCASFAVKLIDLNAPKVDLVSPSVGNVVDVITVNVYIRYFPKDQTKDY
SLARIQGQFGESVVTAISHTTSASSGMDVITFNVGNLRLFGQPSRLLNASVYIIDSFMDP
MPFDFLVVRTPAHPTPVDSSQLGGGSVVFTVFWDLFLQPTTVTVTFSGINAVVTKIADNE
AGTISNVTAVVPLGLKVGYVQVKILSANNLGETSYETLSFEIYDPPTFVNVVPSSATVGG
TVGACSICLSDQQNAVGIWISKAPAIQDISEVQVQFGSTVCDNVKCAVLDAVRWSDGLYI
SSSVPPHSAGSVSLTVTFRGRGEVPAGFTADQVYVREQRRAISGLVFEYYQPSAALVAMD
YCPTCVPGKICISGGLCSDGSEPIRSSDTDCTLPLRGGGILTVTLENAVIDQSFQMSIQG
TYFSGSDIFNVFSSSSSYVFQIQPKPFDKTGTLSGNIVVSAFSTLDFSVLVYDQQLIVYC
RTPQAGALASVTCQGPAVGSVYMYLPGVNPANTDMLSNLKVEFGAKEPRSVSWYTSASYT
QLDVIVASLPTFTRSELSVIEGKASVPIKVSYLSSPSLFYTGSYDIYFAPLLLSARFQSA
GDAIEVEFDQQTNGKSLSADCSFLDVTGLGSGYTCVWQTTKRLIIKLGKSATIVPGDFMN
LKNNFLKSENLISSFSVPLTQPLRIEPPKVQLVPGPGILTGPAVIDSCSALRIVFSIASP
RPLKYTWSSSNSDSLNSILLFLTSNQISMPAGTPALLETNFQYKISVQATDFLGVQSDTK
FFTLTKQASPIPTVLIEGSTSYSVNDPILLRGEAKFSLCQTSKSALSFAWVLSDTTTSTQ
VSDKSQMYLKPGTQAPGKYKVSLTMSMDGDISKRVSASVDINVKATPLFSKIASGTTITI
STLSQLNLDASGSYDPDLRLSERKTDALLKFAWTCVLQTVSGTQLPCLTKDGNAVTLETA
RILTIAADTLTSTGSNYFIFTVTVSKTGKIPASSSVNVYMVSTRIPSVGIQTRDMPFDAK
LGLSKINPDARINLGGVIDVPASQISQYSWTANNGISFTTLSQNLVPLGSNKINFVLRLD
LSSSPILTAGVEYQFTLRVTDNQGRVGSSSINLLVNRPPSSGTCQTCKVSTSTTCETTGI
AYKDYFRTTCSNWIDADLPLSFMFGVTINAKKLDFSPSPINYLDMVLPRGQVVVTAKVLL
HAFHIFSLTIAQVLDSLGAAADAGSTMITISSSAGRRRLLAVQDDIGNGMTALNDAYQLK
SASTVNQLVSNLGNTIAGTTLQATDEAKYRQDLILNLSYAVTYAALTKDYAEETIQAGAS
AIPTPCLISNTTFNGAVSVAKAASSTDMSRDSFSTTMNQNFAIFMGSISGALSVCPYSSE
PVVLSESQLIQFLIDRHASTFPIAEGYAKVIAAGELYTFTGNSLHNLTTTKANFPLVATS
LQVAAAGTGYFTVPQSLSPLPSNVYKIIMFQGVRSNLNKVSSIDLLSQSSVALMLATQDS
STQATVSDLTSPFTVVIPVDPQLVTALGVAGWKNKLSCAFLDPTTKQFRFQGCIVFDRSD
TSVTCRCNHLTEFFAALDPALADCGDKKISQNETCDDGNLVSLDGCSASCQVEPGADCWR
DPGSGTYSICCAPCAPGQYRSGCVSNTVDGVGICSPCAAGTFKPDRGSWDSVCTPCPNGT
SSVAGSAVCGSSCGPGTYPSGADCLPCPYGKYKNTTGNSMCLDWPTCPPGYELYNASASE
SGYCRDIDECKNQSDTCNRVSEVCVNTEGSYRCDCAYGYVKVNNKCVSNCGDGIYIPVEG
CDDGNTKSGDGCSSSCTIESNFVCKNSNSTPSVCTCVANFYNPKEGAKCSRYCSAQYTCL
GHGSCQAEAGYCMCNRYYFGLDCSTVLTPLDSFEFYISDISISYTFSLSSGASLYLPPFA
LSGPTTVSGDLYDSKDLPPAMQVADVVRFAGDVVDLQPDGISVKGAVLGLSVSQQAQADE
VLKVFTFDRDLERWVVVDGSGPDATGRASATLQHFSTYAAMFTKDPNIVVVPSKLGSGSK
AGVIAAAIIVPIFFIGMLVLAYYARLQQAQAGKKKADVEAEAPSEPVYDSSALRSSVIPQ
ASTFDTSAVALPESWINCSACNNPVKSTWPRCPNCRTDIAQAPRPEGRDLVATLGYDHPE
ISEAAAGVDSVSAVSAQTLVEQQGFGGICHQCSAPVKLSWPRCPGCKAKIQRPGETVESA
PAQAFVSSMSQQDVMGFSAECVNCKAPVKPTWKRCPTCRTPIMSDSAPAPATVPATSEAQ
QYQGDTFTPAPEEVTLPGDAS
Download sequence
Identical sequences L1J2K9
jgi|Guith1|140920|fgenesh2_pg.50_#_14 XP_005829738.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]