SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|141050|fgenesh2_pg.51_#_32 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Guith1|141050|fgenesh2_pg.51_#_32
Domain Number - Region: 30-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0276
Family Laminin-type module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|141050|fgenesh2_pg.51_#_32
Sequence length 284
Sequence
MVEERILSLLEMAVFSSVRWNCSRHCPPQFGSCPPTDPVLGQCVCKPNRIGIDCSTHLLT
DHLFLPPYRHPQDTSAWDHQELEGALREVAASQGSGSCAAPAALVTGYHPGGLTASLSLI
ASMLSLSFALNKKTLLWRKAEVEESDNTRSVQPFAWVPPKYQTKELAQELDIDGLMKRLG
LLDGPFFGVHVRLGDSCVKWKELFNGDCLSPYELISHTKSASLLFLTRLSHSPQVDGESA
EERRASSQPAASLYLDRLDPALRRFLSQEARLPRSTFNYGSDSD
Download sequence
Identical sequences L1J281
XP_005829611.1.50599 jgi|Guith1|141050|fgenesh2_pg.51_#_32

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]