SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|142343|fgenesh2_pg.63_#_34 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Guith1|142343|fgenesh2_pg.63_#_34
Domain Number - Region: 491-524
Classification Level Classification E-value
Superfamily ARM repeat 0.00095
Family GUN4-associated domain 0.076
Further Details:      
 
Domain Number - Region: 334-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0209
Family EGF-type module 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|142343|fgenesh2_pg.63_#_34
Sequence length 770
Sequence
MSMYSGLLLLLLTLILSCWSVPFTSGEEEAALETVDTLQEEEVQEEGGGCRFFVFPPADF
EFSDDPPVLTIHIDGCPMGYLRIELHLTTNGHDVLLKNFNVRMGEEKEEPLLGGLQPAQE
EQEMEEEAVRYSRHLTLVLGELVNNYVYQGTVKTFEVSGEGTRPMSVHPMRFTVRMPSTP
QVLISFPPQGWRFEGGSEVQVILTISEGTGERQTSKFVSVLVVWFLNGVYQGVVRNRANQ
FELPTGIERRRRGEYNLTVMLLDIALHPYDANASVLFSVVPEEEKEEERDETEGGKKACL
LREEEVVHNDWATFMFNEYESFSSPANLHQPVNQTAGCQHNCTQGRCVDGVCICNPDFFG
EDCSASPFLHSSFLPEVLTQDLPCTPRQSRDTLERFTPLFLRHVIASQYKQACDRQTIFF
QDISVGNKGIGFALRWLSTALVQDSSVTSNARPPAGSTGRRVPMLIMCRQSRWEEDVVEE
GRRGRRRKWREKKGREMGEEKHEREDEDEDEDEDEDEDEDEDEDGDEGGRGWGRKTTTTR
KKMERERKRTDVFVTSSILAVSTSPLSFVQDIPESLKGMGAVKTEIGFHGSIIGVHVRHG
DSCFDDNRKYNISKVFIASDDPQVIDEARQQLLQERPFDRSQLDSELRIEHRVRHGLVSA
LPPLAPSSLPRLLQVDRRMAVESALIDLLLLQSCDCFILTLRSHFGAAALQLALAARGYL
PPYISLDGPLFPIHDGKHEPYVPNVHHREWVSEHYGQGEFKERNWLERYF
Download sequence
Identical sequences L1IXX2
XP_005827922.1.50599 jgi|Guith1|142343|fgenesh2_pg.63_#_34

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]