SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|142365|fgenesh2_pg.63_#_56 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Guith1|142365|fgenesh2_pg.63_#_56
Domain Number - Region: 202-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00104
Family EGF-type module 0.071
Further Details:      
 
Domain Number - Region: 301-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00254
Family Integrin beta EGF-like domains 0.081
Further Details:      
 
Domain Number - Region: 257-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00355
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 172-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.024
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|142365|fgenesh2_pg.63_#_56
Sequence length 356
Sequence
MAARGSATWARALMVYLVLLSANGDTNWGQKSSQVAGGFKESMASAAGSSLAPVGAREAA
IMQAREQAREQARMQAKEQSMSSVSRESAAANRPQHMPPNVIPTVKPESPPPTAAQQPVR
EGAPRSQGFLSSLLSPAQGVQNVGGGNVKVATWWLMLLQPRGRECVAPGENIECSGKGFC
LDGDKGCKCKNGFVGKFCEIQCPGGGNCNDRGVCLEDGKCLCQKGFSGEACELRQMVGDF
GESHSSSRSRRRESGGPCGENNECSGHGRCLSGEAGETCKCEPGWSGQACSTPCPGLNKE
GMFCSGFGSCTRDGKCRCDAGYWGEMCEKGMCGLKGTCKCEEGWTGLECKEQVGKR
Download sequence
Identical sequences L1IYR2
XP_005827945.1.50599 jgi|Guith1|142365|fgenesh2_pg.63_#_56

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]