SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|142579|fgenesh2_pg.65_#_66 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|142579|fgenesh2_pg.65_#_66
Domain Number 1 Region: 29-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000466
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|142579|fgenesh2_pg.65_#_66
Domain Number - Region: 30-145
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00785
Family Growth factor receptor domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|142579|fgenesh2_pg.65_#_66
Sequence length 367
Sequence
MLYMMDFPLYTLFFISLIENGSRAAALDSTCLSIDGTICFNRGSCIDGRCQCQTGYGGTD
CSMRCPTDIYLNPCSARGTCSNTGNCVCSAGWTGFKCEFECPGGFMNPCSGKGACKSDGF
KSFCECLSNIPDNFTVAYTGRSCELPVFNESSSILGVVHDGDTATGIKLVLAVVPVMITL
FAMFGLCTFYKKRQAVLFIILEDLVGYVRRLFQKSEQEEDLDESVHSPEKEDVTFEEYEL
EVKDDMVLKSFSSIPAYLPGRFLHLGAVKLGLQQLDLDQYLSAAGVTRVQRAIRSIREVH
EFEDRTTDRLTEYKMYVLEAQRTRAVLYCKEAPIDAAFRYLKIVDLPGRPNFSSERRRFR
KRKLSNE
Download sequence
Identical sequences L1IWR3
jgi|Guith1|142579|fgenesh2_pg.65_#_66 XP_005827693.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]