SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|144030|fgenesh2_pg.82_#_13 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|144030|fgenesh2_pg.82_#_13
Domain Number 1 Region: 82-144
Classification Level Classification E-value
Superfamily E set domains 0.00000756
Family E-set domains of sugar-utilizing enzymes 0.047
Further Details:      
 
Domain Number 2 Region: 471-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000838
Family Integrin beta EGF-like domains 0.063
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|144030|fgenesh2_pg.82_#_13
Domain Number - Region: 174-256
Classification Level Classification E-value
Superfamily E set domains 0.000787
Family Other IPT/TIG domains 0.045
Further Details:      
 
Domain Number - Region: 1281-1327
Classification Level Classification E-value
Superfamily ARM repeat 0.00806
Family GUN4-associated domain 0.076
Further Details:      
 
Domain Number - Region: 793-858
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0157
Family Multidrug efflux transporter AcrB transmembrane domain 0.022
Further Details:      
 
Domain Number - Region: 284-352
Classification Level Classification E-value
Superfamily E set domains 0.0434
Family E-set domains of sugar-utilizing enzymes 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|144030|fgenesh2_pg.82_#_13
Sequence length 1502
Sequence
MANVSDAANFTTVPWNQTTPEPNAASTSRPNETVGEAISASSRPNETVGEAISASSRPNE
TVGEAISASTPPPLIGACENSSIAGLSRTNGPTSGGFAVTLLGRFLGTSNDSAVQVRFGS
QSSGEVTWQSDTSIVAQVPAGFSDLGSALRIDTGQDCYIENVPRTFNNVFSYDRPMISRM
QTASSVSTEGGAKATITGMNFGLGDFTPVMLVDSFYKGYEACSTRWVSDSSLISILPPGV
GRGRTIRLEVGGVEASQVCTADNQSSATAMNGSSVQHPCFTVNYSAPAILDVNPKLGPYV
GEQTLTVGGSDFGPEPPAGADGPTIQTSALCKISGGTGTFLPLKIDVGNQSSGAAARLEG
GVNLLSFTFVNVSGPLSVVIEPNQDVGDKKRLAEKFKDDLAYLLFGFCAGISPRAEACGD
YIRAEQVVLGDGGDEDDNNNDHRHGEDLDHHPPSRRRRPSVPRDSTDRPSAYNSLPCSGR
GECVGGGCVCSAGFSGELCDMRASFSRQVINEISSVTFLLALAILLASVTAHALAWFVIT
GMYNIEMVVTGDHWSFLLHIQFVSITSLLATEVPQQYLDWASSFRPMNGQLDPKQVAGWI
GYEWPQGIIFTGFCQAYQNTSAQLDTNSTISSEQVALEDTFRLFLGTCTTSIVLLLLVCC
SRVLAASLRVSIIRWKRRRQKARQKKMREEEEEAEAEAAKMMLNQDEQTSMTVIDEKLTA
RVSGRSFGLSWRLSGKSKQGKERADADKAAGGGDEKETENCQDPKLAAEGGAEEGQNANE
KEEEEEEEEEIPVSMALRFPKWELPVLAFLATGLSTSTGMLINAAVSMRCFPLLGFVIVL
AVCILFVVWLFSRLRKHFVSRPAVWWHRNRLKDAEEGVAAAKHASSRQFRHKCLADYFDA
LQTSGWWEDAVGIKREGKEEEDVEEGKGKSPSGVPSDYRGDADEQEKLKVAGEGEGAEES
MKKIVEIVRTIVQEAALVPALYLRSREGSENARLCSTFDEFLLTARDRLKNVIGNLAARQ
LKSIAITSEVIAQTWTEFATDLLWPSNYDAYYRTVYSDWDPDIVHVNESVLVSLKETLCR
LKEGSQIVIGVVLVLVNIPCVVLLAAKRPYKNRLQNLKQLVTASMRLYLLLLSCYLIQHE
PSYVSTESNPAANEATFIIILVICAAIEAVSPILGCIRAYMAILLVITGLMDRLQAKSDW
SLISRWLLGAMRTRTALYLNAKGLKRQNLPWSTTREHHSPEPPEPRDASRGGEQGEHGLC
GGCRGDSKVVIHLRYALKEEEGGEEQEDKDEDEDEDEDEDEDEMKEGKQKQELERKEEEE
EEEEEEEEGERESGGEEGWGHGVGEVLPRMIAVGTFTANSFASIYLGTEDAMEDLRLSSC
SETFLLRVKERFYRWKRDAASYPEGSAYSRGGWLKDTDRKIAQLLLTEKALKLVDITWVN
VEQAVRGQLISRKPGVTTDEDGVVNKECQFQFGISEQDLNAREELCAEVGHIMNVMELVR
YY
Download sequence
Identical sequences L1IQR8
XP_005825611.1.50599 jgi|Guith1|144030|fgenesh2_pg.82_#_13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]