SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|146364|fgenesh2_pg.123_#_32 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|146364|fgenesh2_pg.123_#_32
Domain Number 1 Region: 787-995
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000128
Family Galacturonase 0.078
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|146364|fgenesh2_pg.123_#_32
Domain Number - Region: 719-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0134
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|146364|fgenesh2_pg.123_#_32
Sequence length 1056
Sequence
MSEIFSFNNVMVSNADRVKNGPVTGSRSITIIASNMGSVTYTGAGRGGHTGCEATEWESE
TSVRCQAGLGARGSGQVSLTAGGQGGAGSRSEAVSWDGPGVYTLSLGEDRRARFDRYLLS
FSGLSYLEANLSSLDTVLFTLTLPSSNDYVALIGGQEYVAFTCVNSSYGLYLLRLTARGL
FGTSVGDHEAGAEVIYYAWKTVGQGNRAGTGSTSMTVYGGAMGVGVHGGRAGRAHGGASY
DGGWASGAGRANGAGTGSTSMTVYGGAMGLGTYTGAGRGGHTGCEATEWESETSVRCQAG
LGARGSGQVSLTAGGQGGAGSRSEAVSWDGPGVYTLSLGEDRRARFDRCNETGADSSCFL
MDTIDRLTTSISSSLSTNLSRLSFVMSVRQMPPSTAYVALIGGQEYVAFTCVNSSYSPYL
LRLTARGLFGTSVGDHEAGAEVIYYAWKTVGQGNRAGTGSTSMTVYGGAMGLGTYTGAGR
GGHTGGSGTEGASYDGGWASGAGRANGAGTGSTSMTVYGGGMGLGTYTGAGRGGHTGCEA
TEWESETSVTPDVKVHYGRQYRQLNVKFHTALALNFVLLSLLVPLLAALLNFYHMNLPWY
GVCNRCTATLLYGLSIPRVDAPVELSITGNSNSLSCVDDLEWRDSNGFGCQNYTENAVAL
ARLYQCGFNGGIITADSGTITDGQDSLVSPGPRQVCCACRGSHYVFECAQGYMQTGYYQG
GEAVCEDINECALGPACNLYKQWDPLTLTYENRRGQCENTIGSYICTCPAAASVCSDIAI
KSAGSWALVEEALDGTTIYVSPGLYEGVCGSWFSRNITIVGIDGAANTVIDCNLQSSFAT
IHHATVTLQGLTIRNGSNASEAGCLFASHSSVTLIDVVLERCSISSSSALSMMSSSLAMI
GVTLDSSQDSYIADLRLENSYASMQSSRWKAGLYNLAFYLVQSELNLSNFSVQNETFTTP
VAMLINSSTIWSDSAIVVFDNSANVTEWCTSITDQQVCAMFACCSWDGYCGPSGNGVPCS
DCTSSNLCTKTTGSACKVMGFTFDNNLLDSQCVWKY
Download sequence
Identical sequences L1II57
jgi|Guith1|146364|fgenesh2_pg.123_#_32 XP_005822609.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]