SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|149224|fgenesh2_pg.302_#_2 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|149224|fgenesh2_pg.302_#_2
Domain Number 1 Region: 2675-2805
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000108
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 3737-3899
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000011
Family Growth factor receptor domain 0.0096
Further Details:      
 
Domain Number 3 Region: 1930-2087
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000314
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 4 Region: 3617-3762
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000314
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 5 Region: 3228-3401
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000412
Family Growth factor receptor domain 0.005
Further Details:      
 
Domain Number 6 Region: 2585-2721
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000502
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 7 Region: 435-600
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000096
Family Growth factor receptor domain 0.0061
Further Details:      
 
Domain Number 8 Region: 1280-1438
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000126
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 9 Region: 924-1084
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000243
Family Growth factor receptor domain 0.0058
Further Details:      
 
Domain Number 10 Region: 642-799
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000271
Family Growth factor receptor domain 0.0068
Further Details:      
 
Domain Number 11 Region: 1404-1538
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000471
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 12 Region: 1679-1836
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000897
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number 13 Region: 2078-2235
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000122
Family Growth factor receptor domain 0.0059
Further Details:      
 
Domain Number 14 Region: 813-950
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000353
Family Growth factor receptor domain 0.0045
Further Details:      
 
Domain Number 15 Region: 2230-2378
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000506
Family Growth factor receptor domain 0.006
Further Details:      
 
Domain Number 16 Region: 3023-3176
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000089
Family Growth factor receptor domain 0.0058
Further Details:      
 
Domain Number 17 Region: 3395-3541
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000218
Family Growth factor receptor domain 0.0033
Further Details:      
 
Domain Number 18 Region: 1850-1986
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000011
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 19 Region: 177-311
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000722
Family Growth factor receptor domain 0.0064
Further Details:      
 
Domain Number 20 Region: 3870-4011
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000195
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 21 Region: 4004-4192
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000207
Family Growth factor receptor domain 0.0076
Further Details:      
 
Domain Number 22 Region: 2932-3052
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000259
Family Growth factor receptor domain 0.007
Further Details:      
 
Domain Number 23 Region: 3-117
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000502
Family Growth factor receptor domain 0.0058
Further Details:      
 
Domain Number 24 Region: 2836-2945
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000167
Family Growth factor receptor domain 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|149224|fgenesh2_pg.302_#_2
Domain Number - Region: 1502-1635
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000101
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 2480-2635
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000102
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number - Region: 2801-2832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00027
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 4145-4245
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00366
Family Growth factor receptor domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|149224|fgenesh2_pg.302_#_2
Sequence length 4585
Sequence
MQDSCIQCGPNSRTLSTGASRALDCLCLPGYYASYQGGCVSCPRGSYKDSLSNDLCTPCD
FGTYLGSTGGTAASDCVPCAVGSTTRDQGQFSPFSCVCDVGYTGKDGSQACTACPSGKFK
TTMGSDPCENCTAYSPECDTCDVNQVIQYSFICEDCNNFRCITCPEGTYRSQRFGLYPSC
YTCPGNSSSPAGSTAITDCVCNDGFTGVITSDSSVCTPCSLGSFATGGGPCNPCPDPYFW
TDGHAGSIDDCFCRYGRYKVVIGIYSHCQDCPDGQFSVDGLTCSACPTGFVGATGSAGCV
CPADYYSGYNSIVYNMITFEGFCSRGVISSPVAQFSVQSSLNERGLRCSVTIRGSLTDSL
VSIENIILSYGSANRFVMSYSGHAACEGLETYSALSFTGVDISGFHFLKNEGTRCIRVDI
YKSDHSDISVDFNIKSICKPCPAFSSLAAGTVDQTSCSCNSGYVLLQGNCYLSTCAAGTY
VVQNSCVNCPANTYKTTSTALYSDCLPCPAHSTSPPGSTSRSMCSCNAGYFGLSAQGECE
DCPAGTYQPSAGQTVCESCSPGFTTEVIAATSEDDCLCPPGTGQEIDAVLGAVCRPCPLG
TYKAVAGASGCRECLLTKTTLQTSSTSPFDCVCLPAFQPDVAGNCYPCPEGHYKAEAGNS
PCIPCVNGVISSDGTACICARGYAGSSPTGTETCTACPAGMSKPFTGPGECSACLPGQYS
PNPASSACIDCAPGFFSPGNVSSCTQCPLNTTTGSSDRSISDCVCTEGYGGSGPWGCRAC
RPGEYKETIGNLPCTPCPNEGVLGPEGSTTVLNCMCGPGYSREGDGTCQPCQAGRWKEST
GDAACTLCPPNSWSPEGNVNRSSCYCLPGFFTASPGVCVECPTGFYNEENGVDVCKRCPP
FSWSMLGSDELTDCLCYQGYYFSAGECLKCLPGTFNPFNGSTFCQDCPEGSTSLPASTRL
AKCFCPVGKTGGNGAVCTDCDFGSYKDINGSASCSPCPLGLSTLSTGSTSLLDCVCAVGY
QLVNGSCAECPFGTYRDSLSQPACVDCPSGFVTSAKGATSIQHCVCPAGQAGRNGISCSP
CVEGTYKQSFSRAPIERYTPSLSFQPSTTLVAPPETVRTVAASFYADVVFPASPPRSTLF
SFGGAAIGLWAGIIRSTAPITMRVRVGNATLSIHPGSVYEGLAYMDFQPPTDGLAHQLYV
SVRVTPGEVLVWIDGQFSGRGVTKGLTPLSSFLWADSGDGSFISAPSSSVPSGEPTAAFP
GSAVSALNYYNPDRIPTLESAVCLPCPLGAVGPEESNSATACTCPPSYRSVYAAEGLVGS
CSLCEANTFLANPGDISCTPCPGNRTSPEGSVSVFDCSCLPGYIGQPGHACVGCNLGTYR
LNETHCEPCPPFRTSDFAADSVDECYCIPGYFLGSGKCEPCAAGTYWDLGICRSCPDNAD
SPEASVDITRCSCNPGYTGRNGEECVPCNPGTYKLGSDPGICFNCPKNTVSPPASGSVLD
CVCQAGYTGADGAECAACQAGKFKASIGSEDCTGCPGGSTSLIASISPLNCTCKPAFQPT
ESGCEPCPIGTYKDNSLNQPCFTCPRNSSTVAVGSEFITACQCVGGYVGERGGPCVPCNS
SSYKITYLTCQPCGTGQYSPPASDSIESCVCGEGFYPVQEGCAPCNPGAFKNWVGDDACE
ICPENTTTLNYGSVSSESCTCVPGFHRLNEGSACEKCPSNTYKNVSGETGCSPCPQHSTS
PAGSVSIQECICGDRFTRFGDICSQCEAGFTYNNITFECEKCSGQRTTVENDVNLYQCYC
PAGYRFSQPPGTCLPCRFGEFRPFSPTDSCSLCPPNSTTIIAASPTAENCVCLQGFTGQA
SSCSLCPASTYKNATGAEPCTPCPNNSVSNLGSTSRFQCQCLPGYTSPAGVLCQQCGNNT
FKEGLGNLGCIPCFDNSVSPPGSNSSESCICDAGSYLRAPSFCDSCPLGTYKDAIGNQDC
RDCPGNTKTVILGATSVEVCVCVPGYLYDPDVGDCVECPQGFFLDGSGGICTRCPENMTT
VAAASATPNSCRCKPGYSPDDNGVCKACRANTYKGSVSQNPCTPCPERTVSPAASTDVDM
CVCDRGYTSLLGLCVACDAGKYKDSTGNQACTPCPDDSTSPQGAANVTQCRCNPGYEGNS
AVGCTACQAGFYNDDGQVSCKRCPTNSTSPPASPLLSSCACIPGYYGQNGVDCEACPSGK
YKSLTGDYACLPCPDDSDSQPASASQSLCLCNPGFYGPGGGPCAQCDAGRYSSGSGFSAC
LSCPEHSSSPLQSDSPLDCVCNRGFIESTRVNGVPTCTACPTGEYEDSGSCLPCPENSTS
LTQAGVGVAACKCLPGYTGPDGGPCSPCPSNSYKPNHGEFSRMNLLNQSWAFPALSTTVY
AADKAMDGSTATCAETGVESCADCSLTGIDVSVGNFTDFTVSPFCGSYISLAGGAPITFA
CSLVGSFFTPYLASTTLDDCQECPTGSVSPAGSTNEDTCVCKPGFEPGSSSYCQECPMGS
FKAITSMLPCQACPEDTYQPNLGANRSASCLVCPDHSFSSAGSVAISECLCDVGYARVGD
TCSHCNFGFYKDTTGNGACTECPTHTTTPTIASASLESCECLPGFEAPTHGVACTDIDEC
SALASPCPLNAFCTNTVGSYTCTCLTGWYPVIGQCQDVDECRQGTDTCDKNVSFCENTQG
SFMCFCKEGYYYSLSESACVNLNECAAAVAPCPISSVCTDTVGSFECNCIEGYGEDPETG
LCINLDECAGNPCFENSMCIDLDGSYRCECKPGFTFDATNTSCLDHATCSNTPGSFLCTC
NEGYRGPGYYCECAICVDCPAGSYCFNETQFLCPPFSTSPPNSQSNFFCTCFDGFYSTSL
FTTECLLCPSGFSCYDNGIYNCTEFSTSTTGSGSCVCDPGYYADPNSIRYKCLTCPENFY
CEGGSNIARCPLNRYSLPATSNASNCFCAAGSYTSASGECFDCQELTYCPFGTPEPLDCP
ANTYSAARSSSKADCLCEVGYGSYNNSDCRLCPAGYWKDFRATVPCSPCPGNTYLPEIGT
VNASDCRACPANSTSPSGTPLISQCLCVRGYYREGDACLSCPAGFYSDNLNQFTCTPCGD
NQYSTVSTSPSASNCVSCTGNSTRVAIDVASCLCNPGFAGGIHQGGLTCTQCEKGYSKAT
FGNVSCTICPNNTYADERGLSACKTCQPNSVSPPGSVSPSECLCEPGYEYNSGECQICRP
GTYKVGFGNSARCLKCPEDTFLQSDGGSSIDQCIRCPSNAISRNGSSSVSNCSCVPGYYA
VDGDITFVCRECGPGYYAARYNQSVCDACPAGTYSEDLTAVAESDCQKCPDNTTSDNHTG
NITGCRCTHGHFGRNGQACSPCPVGTYKDAQGDLPCEICPDDRYSDTLAAVSVGFCLECP
SHSTSFDSIKATLAACLCDPGYTGTFGNCSACIPGGYKTTYGSAECTPCPNNTYSTTPAA
ISEDSCQPCRENSISAEGTAVELGCQCLGGFGYVSGKCTKCLEGYYKDTVSNRVCEACPT
DTYNPLNQSSRSSDCLACTNFSSSPEASTRKTDCECDDGYGGPDGGPCAACPDGFFSNAS
ETACIECGFGQTSLSDRSSCRPCLSGTHGPQPANPFCPECFPGSYQEYSGQSFCSLCPIG
KASRAEGSNTSLTCQNCSAGYHAPSPGTSSCLICTGGTYSLAASGECIPCDQGSVSLPGF
SACLQCVPQTYADANATHCEDCEEGTYSDFGYTSCISCEPGYRLDFGLRECIGCDNNTYS
NEFRLVCRDCPPNSTSPALSGSVFDCVCAEGYEIQLVAGVYQCVACLVGHYRGPGMLFCE
PCPPGYFGNSPALAQCEPCPAGFYEDTNGSSACIPCDFDTYQPIIAATRAEQCLPCPANS
ITYRAAAEFQYDCRCVPGYEYRLQPVASGGYDMACTACQPGKFKDSTLNEACRPCERGSY
AAGNASLYCEYCPLGTSGIAKGQTSCPPCKEGYYASNSIEVVSGCVPCPSGMTTLFTGSQ
STGSCRCLPGNTPVDPLVPLKGCRTCYPGHYKPGVSNLPCSSCDFNTYQPEYGAVDSSSC
LSCPNHSLSLSSTASIDGCICESGYERIGEDTCSPCSPGNYKPSLSNTEVCVPCSVGYFS
ELPASSFCTPCTAIGLYTTTATSASNSSDSCKCIPDYGLASMTNATKTCVPCGALSFKKG
LGDQPCQSCPLSDSIAKHYLVTDYSCLARCDPGYILDEAYDACQPESKLLSPVTDDLIIT
NVSGDGFHDAIIGSMLLRHTSGTSIPVLYVSRSIPRVECKACCLSEIQGDTSEELLPASL
SVTYQTCPNGTCNCEELENAFYDKYVPYGQDTYGFMTLSPAYGGLYRFSIDAAALEPVVN
CTPWGQGWLNCSFYIAATFIQVDSTLSATYHTVYHRVSYSRGVSASVSVIQKVQPGMVSY
LSLSLYRFASSNMYAARFVFGGDEELLVRAQAMTYILRYGGWKGWDVIDEQRICASLAPL
PSCWSGSPVLHGAVVIDQNTAGAHCERLFTWRPGWPMYVIFQTPQLANEFDTARGWPSQG
NSWKPARRASSRWTKGSSPPPSASG
Download sequence
Identical sequences L1I6R0
XP_005818535.1.50599 jgi|Guith1|149224|fgenesh2_pg.302_#_2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]