SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|166344|estExt_fgenesh2_pg.C_1620012 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|166344|estExt_fgenesh2_pg.C_1620012
Domain Number 1 Region: 157-444
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.84e-65
Family Regulator of chromosome condensation RCC1 0.0029
Further Details:      
 
Domain Number 2 Region: 19-193
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.14e-18
Family Regulator of chromosome condensation RCC1 0.049
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|166344|estExt_fgenesh2_pg.C_1620012
Domain Number - Region: 478-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00293
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 684-710
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00816
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number - Region: 546-580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0806
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|166344|estExt_fgenesh2_pg.C_1620012
Sequence length 784
Sequence
MKWKPWAKRASIACLSLACFFDVVAANDVYVVGYNDWGQLGLGDYLERTTETLIDSKLPL
DRTYGLAAGLYHSVALGDTSSTQGLVYTWGRNSKGQLGLGPIWTSLSPQAVQWKACPEPN
SWVCNPSLCKPVCDASKCTSYGSANSYWKVLGVDKASDMQCMKPQDVVWGSASQPQIVQT
VASVDSTFVLTKQEMLARPDGKYFRSVPMLINSIQDLHFLELAAGDFHVIALNDLGEVWS
WGNNVEGQLGVGDLSQRSQPAKVVYMDGLNTVKVAAGSYHSLVLTDFGQVYSMGLNANGQ
LGLGDYSSRKAPTLIKYLATKNISSIACGDYASYAISDAGEVFAWGDNSFGQLGQSAAVT
YNEPSLIPSLKNDGANVYKVFGGQRTIFAIDESGIVYAFGNNDYGMLGLGDKTTRKFPTK
ISSFVGANVYVIASGAYHTIAATGCWEQGNPCSGHGTCNSNGVCICDTGYRGSVCSDQCP
GGVGNACSLHGDCIIPGTGSSYCLCFSGYTGSACEIECPGGALNPCSGNGECLPTGVCEC
NSAHHPCRCPGAMSSPCSDLGLCVNGACSCYTGFTGLNCSTECEGGASNPCSYNGECLLD
GSCRCYTGFRRPDWCRVPDLVPPHDPLPSSCECPGGHDNICYGHGTCTQDCVCSCRVGYR
GANCSLQCAGGLLAYLEGELVTVKVCSGHGECDEQGACLCYGGWSGKICDNGPYDWLPVI
LISSSSFLVCCCCICVGICIRRRQKKFSNRERKRQARRKLRGKKKHKSGDRKKDRSRKKS
KINK
Download sequence
Identical sequences L1IDD2
XP_005820899.1.50599 jgi|Guith1|166344|estExt_fgenesh2_pg.C_1620012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]