SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|46324|gw1.64.51.1 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|46324|gw1.64.51.1
Domain Number 1 Region: 103-141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000059
Family EGF-type module 0.049
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|46324|gw1.64.51.1
Domain Number - Region: 29-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000226
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 68-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000528
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 142-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00181
Family Integrin beta EGF-like domains 0.06
Further Details:      
 
Domain Number - Region: 6-27
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0958
Family EGF-type module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|46324|gw1.64.51.1
Sequence length 205
Sequence
ICNARGECNYQTAICACNNGWQGQNCTAECPGGEASPCSRQGDCMPSGVNGAVCACYPGF
RGGDCSIECIGGSSSPCLNHGFCEADGSCSCYGGWRGADCSIACPGGSVTPCNGHGLCEA
RLDSNIAKCICNNGFRGDNCMIECKGGSSNPCSGHGTCGADGSCTCTLGWTGSACENACP
GQDLPCSGHGTCVGINVTGCSVGCY
Download sequence
Identical sequences L1IYC0
XP_005827869.1.50599 jgi|Guith1|46324|gw1.64.51.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]