SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|46501|gw1.121.6.1 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Guith1|46501|gw1.121.6.1
Domain Number - Region: 50-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00114
Family Integrin beta EGF-like domains 0.053
Further Details:      
 
Domain Number - Region: 5-28
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00355
Family Integrin beta EGF-like domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|46501|gw1.121.6.1
Sequence length 79
Sequence
CPNDCNGHGTCEWGFCICDAGFKAVDCSELSCPQAQCSFSYSDHWLTCLECHNHGLCNTS
GFCLCNQGWGGESCQLISC
Download sequence
Identical sequences L1IHJ1
XP_005822693.1.50599 jgi|Guith1|46501|gw1.121.6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]