SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|62779|e_gw1.1.93.1 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|62779|e_gw1.1.93.1
Domain Number 1 Region: 2-178,207-265
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.59e-26
Family Legume lectins 0.0076
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|62779|e_gw1.1.93.1
Domain Number - Region: 273-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|62779|e_gw1.1.93.1
Sequence length 300
Sequence
FQFLSFSRPVGLQLLSSANINQNSSTLDLTSPSNNSIGAVWYSIPQRVAQGFVMDFRFLL
HSFSSVCNSWNYGTNSNEYCTLRRGEGFAFMLVGGGDGMPAYGDGGAQLGYGGLRKSLAI
EFDVTVNPQLGDAGQNHISIHSRGSEPNSAAHTFSIAQTPQLPILFDGNEHHVRIRYDHS
IPSSYLKDPCFKVSQYGARFLSSSPRRDLGSLTVWIDDFDRPVLVTALNLMSFLAYPPQG
TAWVGFTASTGSEFMVASIREWNLQVGACMDDCNDNGFCLDGFCICDEGFRGSSCRDVNV
Download sequence
Identical sequences L1K529
XP_005842448.1.50599 jgi|Guith1|62779|e_gw1.1.93.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]