SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|64648|e_gw1.7.145.1 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|64648|e_gw1.7.145.1
Domain Number 1 Region: 232-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000729
Family EGF-type module 0.069
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|64648|e_gw1.7.145.1
Domain Number - Region: 268-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000128
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 201-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000208
Family EGF-type module 0.079
Further Details:      
 
Domain Number - Region: 299-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000729
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 88-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00157
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number - Region: 56-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00401
Family Integrin beta EGF-like domains 0.072
Further Details:      
 
Domain Number - Region: 168-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0131
Family Integrin beta EGF-like domains 0.052
Further Details:      
 
Domain Number - Region: 122-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.062
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|64648|e_gw1.7.145.1
Sequence length 359
Sequence
MKGYTISSSAFLILALCCTSDTTSQVIQQPGYNVNCGLGFAGGRCERVRTCEDLGFCYGH
GICQRGPRCLCSPGWTSANCSQSLCPSNCSGHGSCSSAGGCICDSGYTGTICSQAICLGS
GNCSGHGLCLPGGICTCDKGYLGLGCEVIDAAQKCSNHDCSLALCLNNCSQHGICDSSTG
QCNCDLGWSGSDCSNQMCYNNCSGHGTCSDGVCTCQNGYEGVDCNTMSCYNSCSGHGSCN
NGTCSCDIQWTGIGCEIFVASSTCAGSCSGRGSCQNGTCICDLGWSGVDCTSPVDCPFNC
SGHGLCTNATCACDFGFSGLGCESSQCFNNCSAHGICTNNRTCECDPGYYAIDCSLPAI
Download sequence
Identical sequences L1JX93
jgi|Guith1|64648|e_gw1.7.145.1 XP_005839962.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]