SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|64838|e_gw1.7.117.1 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|64838|e_gw1.7.117.1
Domain Number 1 Region: 25-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000355
Family Integrin beta EGF-like domains 0.078
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|64838|e_gw1.7.117.1
Domain Number - Region: 106-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00645
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 216-255
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.00732
Family ABC transporter transmembrane region 0.018
Further Details:      
 
Domain Number - Region: 182-216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.03
Family Integrin beta EGF-like domains 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|64838|e_gw1.7.117.1
Sequence length 287
Sequence
CLAGCMQDGTCVCSYGWTGSACNVECKGGASNPCSNHGICRTDGMCICDRGWTGADCSIE
CAGAAENPNHWPCHLHGNCEGWFINPQTQFQYGLACEIECPGGAHSICSRHGVCDDVGEC
SCFKGFRNKSCEVACLGQRDCNPATGCEGVCNYAGSCQEDGSCICEAAFRGSACELVCPP
FTGLASDICNLRGVCNAEGVCNCYVWYQGVACEQIASWVIAVVVLFTLALIAVSVHLIRR
WLHNRMRARRRARRERRKVRRTEAAVNRMKGYKVPIPDDMSMQAKGI
Download sequence
Identical sequences L1JWW3
XP_005840056.1.50599 jgi|Guith1|64838|e_gw1.7.117.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]