SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|68767|e_gw1.22.100.1 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Guith1|68767|e_gw1.22.100.1
Domain Number - Region: 26-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00178
Family EGF-type module 0.079
Further Details:      
 
Domain Number - Region: 115-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00607
Family EGF-type module 0.059
Further Details:      
 
Domain Number - Region: 237-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0209
Family EGF-type module 0.052
Further Details:      
 
Domain Number - Region: 158-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0639
Family Laminin-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|68767|e_gw1.22.100.1
Sequence length 316
Sequence
MSVDVIGKSCSLDFYGADCTQHCSNEATCSGHGYCQGDGSCQCFQGWAGTNCDVEKTLYQ
HECSTDSECQAAISVNSTCTQKGICECTSHSAGPTCLSCATDLYGLHCDRYCSNEATCNG
NGICQGDGSCKCFQGWAGTNCDVEKTLYQHECSTDSECQAAISVNSTCTQKGICECTSHS
AGPTCLSCATDLYGLHCDRYCSNKETCNGNGICQGDGSCKCFQGWAGECSTYCQAEVTCY
GHGTCGGDGRCQCYNGWGGERCNQTDVLPVGSALVQRGSSSAIVASDGAASVRPAPPVLP
LNMQRQTVPRGATQSA
Download sequence
Identical sequences L1JI90
XP_005835223.1.50599 jgi|Guith1|68767|e_gw1.22.100.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]