SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|69169|e_gw1.24.133.1 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|69169|e_gw1.24.133.1
Domain Number 1 Region: 311-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000516
Family Integrin beta EGF-like domains 0.047
Further Details:      
 
Domain Number 2 Region: 221-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000264
Family EGF-type module 0.032
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|69169|e_gw1.24.133.1
Domain Number - Region: 488-513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00021
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 352-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00155
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 188-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00248
Family Integrin beta EGF-like domains 0.082
Further Details:      
 
Domain Number - Region: 383-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00297
Family EGF-type module 0.055
Further Details:      
 
Domain Number - Region: 49-70
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00436
Family EGF-type module 0.086
Further Details:      
 
Domain Number - Region: 155-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00704
Family EGF-type module 0.058
Further Details:      
 
Domain Number - Region: 444-469
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family Integrin beta EGF-like domains 0.05
Further Details:      
 
Domain Number - Region: 415-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0484
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 82-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0604
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|69169|e_gw1.24.133.1
Sequence length 529
Sequence
MAFATRSRSVAIVPLGSQERTAPWHCALTIALVGFDAVWCRPFPDGYPGHGVCIDGKCAC
VGNYTGASCSSILCPNDCSGRGLNCSGHGACIDGSVCECTAGWYSTDCSLQWQTNDTCPS
SCSYHGSCMNGVCVSLSYFICSCTPIQMTGSCITNCSGHGQCVGTGTCNCDPTWVGQDCS
LASANGCPADCSNRGTCTQNNTCLCDQGWVGIICDTPMVYDSCNLNCTSRGMCVNSTTCV
CDPGYTGIYCELSMPVNGLIPSAVNTTSICPMGCSGHGACSANGMCLCDVSYVGIDCSIQ
ISSISLSCPMDCNARGMCQSGTCLCDPGWWGDSCQYDFKCLNNCTGHGVSGCSGHGICAN
TSCACSPGWSGEDCSKLSCPSGCSSRGVCQSDGTCFCDAGYSGSACEISLCPSGCSGHGA
CTHNGTCVCYKNFEGADCSILVDCNRRGKRICGFCNCEAGYRGEECEIDMCADSRIYQNG
DYTKPIQVCSGHGLCSSLGCICDEGWSGMNCSRPAVCSGEVVCLMNLHD
Download sequence
Identical sequences L1JHU3
jgi|Guith1|69169|e_gw1.24.133.1 XP_005834694.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]