SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|81377|e_gw1.178.9.1 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Guith1|81377|e_gw1.178.9.1
Domain Number - Region: 234-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family Integrin beta EGF-like domains 0.073
Further Details:      
 
Domain Number - Region: 301-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family Integrin beta EGF-like domains 0.068
Further Details:      
 
Domain Number - Region: 167-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00272
Family Integrin beta EGF-like domains 0.06
Further Details:      
 
Domain Number - Region: 50-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00628
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 87-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00795
Family Integrin beta EGF-like domains 0.068
Further Details:      
 
Domain Number - Region: 129-157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family Integrin beta EGF-like domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|81377|e_gw1.178.9.1
Sequence length 394
Sequence
MNINNNYLESTSQISLPTTYWWKTKNISKQVCRQTKYNANCTAYCDAFINCSGHGRCRGV
DGRCECLAGWAGERCNRTFARQPAEAGTTCSGHGRCRGVDGRCECLAGWAGERCNDVYGG
NCSAACKAGTTCSGHGRCRGVDGRCECLAGWAGERCNGTARAACEAGTTCSGHGRCRGVD
GRCKCFPSWAGERCNVSAGAAGSGSCGEGFAGPGCRACSQDVYGGNCSAACEAGTTCSGH
GRCRGVDGRCECLAGWAGERCNVSAGAAGSGSCGEGFAGPGCRACSQDVYGENCSAACEA
GTTCSGHGRCRGVDGRCECLAGWAGERCNVSAGAAGSGSCGEGFAGPGCRACSQDVYGEN
CSAACEAGTTCSGHGRCRGVDGRCECSRLGGRAM
Download sequence
Identical sequences L1ICC9
XP_005820475.1.50599 jgi|Guith1|81377|e_gw1.178.9.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]