SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|99047|au.1_g149 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|99047|au.1_g149
Domain Number 1 Region: 1418-1540
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000332
Family C-type lectin domain 0.01
Further Details:      
 
Domain Number 2 Region: 287-341
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000641
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 350-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.028
Further Details:      
 
Domain Number 4 Region: 158-212
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000222
Family TSP-1 type 1 repeat 0.0074
Further Details:      
 
Domain Number 5 Region: 391-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000641
Family EGF-type module 0.008
Further Details:      
 
Domain Number 6 Region: 393-512
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000188
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 7 Region: 754-904
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000095
Family Clostridium neurotoxins, the second last domain 0.061
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|99047|au.1_g149
Domain Number - Region: 1157-1232
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000225
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 212-266
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000235
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|99047|au.1_g149
Sequence length 1544
Sequence
MKTQDEQLTMRELEMEIRSLKKELSASLETLKSLNASFASLPQLPWEATGRMKIGGLGLL
MQRGRYEVWVCDYENRCVQEAGDAMCFVFDEVQEVFLPWGLDSQLLLTTPEPFQPDLAIS
QILTQLKALQQQIRSGGCGGSCLNQTDVQLLLDRYYLEPGYLWSASRFSECSSLCGSGVA
RRSITCISKLQAPVEDFHCSNRSKPLAEVPCLNFSQCSYEWDIGAYSECLSACGPGYRRR
SIACRRSDSMSMDWTKCLGSTPVEEEVSYAHLLSFSDLAHQPCIDFSSCSYRWSTSAWES
CSSTCGSGLQYRSVICIRSDGVEVEDGMCEGSKPRTFQACTGASGCNYTLINECAMHTDN
CATHARCIDTYASFECICKEGYLGSGTMCEDEDECVTKSGLCDAATTTCVNTEGSFQCLC
SLGFYLDIMSPSSSCISCRTGHYTSEPGQTTCSLCAPGYYGSVSRNCTSCPPGSSSLAGS
QQVSDCKCQYGFSGIISNSSDSCKPIFSNVEEQSRWFRLGASGMSCAETCAAEGKTCVSS
AINQIVDEETMQSAMRAASIASDRRIRGAMTEPQKRPGALHFRMSAGAHGAGGNALQDLT
ANSGHVRHRRYVEHGVTKFLVIPTGSVWNIWISQYMYVEIPTELKGSRRVTISVTVDNAR
SSDQAKECYMRLAGRRYNFYDTHTGVFRPLQQIHLRVELPMEEATADGIRIGPIYTSSAR
IDSASFYGPSWRISVGEMKEIEEPLSVMSDGELKYVNGSTNDVVIFPPSSIPSPVFTLCS
ISRYNGGIRNRVLQASSSNFLHGHWNGGRGQAFYDGSWNLKQDLSNSADAWVVLCGQNHK
YGKFFLNGVDYVGSAEGLLGNLQLSINEVGLDAIDGFIPESSDWALSEVAIWRGALREDE
IRAVSAHMMHMLSSGSSAPYNQTLNLSCEVVSGGNYIISPHVSAEGCYFHSSSSPSTCEA
SMFGASRVCVCAAPCLEDFYGEGDNCFRCPFFSHSSPASSTIHDCSCEQGLMSPYGSSSV
LDCMCEAGSYGSAGNCSLCPAHSTSIAGSRTVDECLCLAGYGVRATGYGRLITSPNDQCE
LYEGEFFASDTPGQSCSQICGSKNMSCLEEAQLFSKDDVSALCAYFSFPVSEYIADSSSD
APSYNPTTGQAFFSLGTPGTCSASNSSNIRTCRCTCNRNEYGEGSTCSSCPANSYSAFSA
QRRSSCMCNSGYFYDAARGGCQLCPNSTYTTVMELKDNDFKRNGSMGWRGTERTTSCGAY
GSVLGGLHVLAEHSSIEKTFTRLCKHVSVYVQFKVLLIDVIQPVKVGLYINREEVWSQTL
PANRFSGSECGWSEGDGIVSDVLRVNPREDYVEAKLRVDYDYWEVNTSNAKTFWGLQEFR
LFVPCMSSTSADCTMTTPSRQTCSDVTLNGEGSLCIQSGDFLYVNYPYRYLSWEAAESKC
NELGIEGHLAYFPDAETYDDVAAAFGLSFGWIGLRSGGGPLGFDFRWYQGEAPTFSRFPA
LVFLDSYKELCVYASGIPFRQTDWDVSNCRSSRSTFVCSYLAMN
Download sequence
Identical sequences L1K390
jgi|Guith1|99047|au.1_g149 XP_005842246.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]