SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|99792|au.3_g894 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Guith1|99792|au.3_g894
Domain Number - Region: 277-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000296
Family EGF-type module 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|99792|au.3_g894
Sequence length 640
Sequence
MGRLMRSDRLVLALLGLALCFGAEYDRDDNGSRVEKSRQDEADQEPECMFMLLSPELDVV
YEGRIPSFEIQVSPACPCPSNGEHEIAIWISRESNKRHLNVVTNMSCTFLQEDFGLIDLI
DIKDGHWEGGVTFNTLWGMHQPVRFDFVSPFNPQIDVLLPTPGYVYGAGVDPVIVLHIHD
ITDPHEPLLGILVRITVNGVEGAITRNPGRDKYIHLRESAEGEYFPDGRYDIQLQVLDLL
YRPRGEPVSLDVVIDRSKPPASKSDRVLHDCPAPADISRCPNCSSHGTCRGDIVCECDAD
WIGDTCQHHMLTHTHFLPDLDKEDTATRCHRRSRWVNSTRRIAAAIQQQQNPPSCSDEHV
QYLTDMNRHPLAVGHGLRWEALMLGESLKNKSIYLPGPTWSLFSYHKCAGLGLWCHLEHP
TTCKAANMSSVREIASQVLVTHVTRRWDFAEGFHDVGMFNWFSTLMGLTVRPRSLLHSEL
NHMKNVIGFKHPIIGVHIRYGDGCLPNQLHRPPCEPVETYVEEIMRMVMKYEVSTVFLAT
DSAQALEQLKSNFDFETLHAPVDRSLFDSRWWIDHRAAFGVVDPMQVGESALMDLLLLSE
CDYFIGTFSSHFSLAAFELSTFKKGYVPPYVSYICILSSA
Download sequence
Identical sequences L1K1K7
XP_005841295.1.50599 jgi|Guith1|99792|au.3_g894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]