SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|72776|e_gw1.44.51.1 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|72776|e_gw1.44.51.1
Domain Number 1 Region: 154-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000247
Family EGF-type module 0.064
Further Details:      
 
Domain Number 2 Region: 67-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000182
Family Integrin beta EGF-like domains 0.042
Further Details:      
 
Domain Number 3 Region: 266-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000193
Family EGF-type module 0.042
Further Details:      
 
Weak hits

Sequence:  jgi|Guith1|72776|e_gw1.44.51.1
Domain Number - Region: 390-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000101
Family EGF-type module 0.081
Further Details:      
 
Domain Number - Region: 23-47
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000135
Family Integrin beta EGF-like domains 0.037
Further Details:      
 
Domain Number - Region: 319-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 354-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000754
Family Integrin beta EGF-like domains 0.036
Further Details:      
 
Domain Number - Region: 227-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00289
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 192-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00964
Family Integrin beta EGF-like domains 0.045
Further Details:      
 
Domain Number - Region: 467-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0101
Family Integrin beta EGF-like domains 0.038
Further Details:      
 
Domain Number - Region: 98-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.015
Family EGF-type module 0.09
Further Details:      
 
Domain Number - Region: 436-463
Classification Level Classification E-value
Superfamily EGF/Laminin 0.067
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|72776|e_gw1.44.51.1
Sequence length 529
Sequence
MCFLTSLRYTGPDCSIALCPFDCWGHGVCLDGKCICDQSWTGFDCSLPNCPNGCSGRGIC
QVTTYHFHCSGHGVCQQGLCICDIGWSGEDCSNAVQCPANCMNHGACINGTCACTLGWTG
IDCSSAWNDPLCNCTTPTMVTNSKSIPSSTCPSNCSGHGLCSQGKCVCDPGFSGQSCQYL
TATSSSVQCVNNCSGHGTCSPFGCVCDSTWFFVDCSMQVVPQSICKWNCSGRGICSNGIC
QCDPGYHGVGCESAYSISWVSNCINNCSSHGVCTNGTCLCDQGYMGDDCHSIIQTWHPLR
ISNNTISRIPLIPSCEFFGCSGHGSCANGVCVCDPYYYGWRCENFITMPCPNDCSLHGNC
MNGTCICDLHWGGKDCSIFESCDPFSSTPPCSGRGNCLNGTCTCNEGWRGYDCSIPTSDC
SFKQCPTSAAFLVPYEPCSGHGACLQNGTCECYTNYRGLDCAILYDCSGAGKRVCGKCIC
DEGFKGIDCSIDMCKDSRIMNPLFPGIYSKSTVCSGNGTCTTSKGCVCN
Download sequence
Identical sequences L1J5F4
XP_005830726.1.50599 jgi|Guith1|72776|e_gw1.44.51.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]