SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Guith1|84878|estExt_Genewise1Plus.C_100078 from Guillardia theta CCMP2712 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Guith1|84878|estExt_Genewise1Plus.C_100078
Domain Number 1 Region: 218-287
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-23
Family SH3-domain 0.00071
Further Details:      
 
Domain Number 2 Region: 11-147
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.22e-17
Family BAR domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Guith1|84878|estExt_Genewise1Plus.C_100078
Sequence length 288
Sequence
MSVSLCDLFSQLCEELVPSVSSQWDLAVIAPSNRMRGRFQAIREDHNRRNRYVADLDHYK
NKLLRCEAEQHKNNSAKNQEKVKETEAKLQAADVRYQQINKNLTSRLKIAEEHKNAMVDE
ALLSMVSLLRTIHEQTATRLAALDQLSDNEQSRQAARMSRQTLARLDRETQMEQGVSGKS
PEEPVSPSRGRWSDSMLPPPHHPDHNNSNIIAVDMSKLSVQSQPMSPRPLSTIVVRALYD
YDATADTELDLRYGDLVTVLKQDRSGWWQGEVDGRIGWFPFNYVQVLP
Download sequence
Identical sequences L1JTE1
jgi|Guith1|84878|estExt_Genewise1Plus.C_100078 XP_005838791.1.50599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]