SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|343082853|ref|YP_004772148.1| from Cyclobacterium marinum DSM 745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|343082853|ref|YP_004772148.1|
Domain Number 1 Region: 6-431
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.55e-99
Family GABA-aminotransferase-like 0.000000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|343082853|ref|YP_004772148.1|
Sequence length 437
Comment class III aminotransferase [Cyclobacterium marinum DSM 745]
Sequence
MTTEKYQKSADLLARAKNVLAGGVSSEFRKYNHPHALFYSHGSGSRIYDVDGNEYRDFTL
SQGPLILGHSHPEVLKAVHDYSSKGQLFAGQHIMELELAEKLQELIPSAEMMRFCLDGSE
AVQTAFRVARSKTGKSKFLRFEGHYHGWLDNVCFGISTPSPEALGPRKAPTPSPWSQGLP
PDAINEFHLLPWNDLDLVKAKLAESHHEIAAIITEPIMCNNGCIVPKEGFLQGLRELCDE
YNIALIFDEVITGFRIGLKGAQTYFGITPDMSIFAKAIGSGYPISAIVGKKEWMEEISSA
RVIHAGTMNTANPTVAAAMATVSVLEREDPYAKMFELGDQLRAGLKEIAKKTGHNMIVSG
IGPIIHTGFSDGEALSEFRDVLKLDKAKLGQFISGLHDDGVRVIGRGLWYLSAVHTEEDI
LFALKSVEKVLMKMNEK
Download sequence
Identical sequences G0J0K1
WP_014018216.1.78327 gi|343082853|ref|YP_004772148.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]