SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|343082857|ref|YP_004772152.1| from Cyclobacterium marinum DSM 745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|343082857|ref|YP_004772152.1|
Domain Number 1 Region: 364-741
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.42e-77
Family GABA-aminotransferase-like 0.0000317
Further Details:      
 
Domain Number 2 Region: 30-270,306-331
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 1.51e-26
Family PP1699/LP2961-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|343082857|ref|YP_004772152.1|
Sequence length 770
Comment class III aminotransferase [Cyclobacterium marinum DSM 745]
Sequence
MLEKENKPWQLRPEDLATIEELASFVPEKFYDIHAHWYRKADLNAPENSFWNSGPEIAGH
EQWKDYTQQLLPKTSLLGGLFFPAPLPKVNLSAVNQFLFDELEKSTLSRGLMLVKPETSQ
KELELGLSHAKVVGFKPYHVYSTETPTSQSGITGFLPEPIWATAHEHGAVIMLHIMKDKA
LLDPQNCEDIQRLCLKYPNVKLILAHCGRSFHALHAEGAKFLNSIPNIWFDMSGICEMQA
ILPILKHFGPEKLMFGTDFPVSQIRGKCVSIGNGFIWLDENNCNWDQAWGKPTLVGLESL
TALQETANNFGLDKSDLNLIFWGNAMHLLNLNEHSPTTNQAYYKHAKTRIPGGTQLLSKR
PENMAPNHWPPYFKKASGCEIWDLDGKHFYDFSTNAVGSCILGYAHPEINKAIIKKVNLG
NMCSLNPPEEVALADKLCEIHPWADQARFVRGGGEACAVAVRIARATTGRDKIALCGYHG
WQDWYLAANLGENDALKGHLLPGLSPEGVPDALRNTSFPFKYNDLEAFQEIINQQPDLAA
VIMEPCRYENPADGFLEAIRSITKKHGIMLIMDEITVGWRLHFGGMHLKYGIEPDMAVFA
KALGNGYPIGAVIGTKAAMEGAQRSFISSTYWTESLGPVAALATIAAMEKQDIQKAIEHS
GQQVQGILQTTAASENLPLQVKGFPALTSFSFDHPESEILRTIFTQQMLSKGFLAATSFY
PTLAHNEKIIAAYKQALAETFGSLSQVIKENSFEKWPKEEKAHSGFSRLL
Download sequence
Identical sequences G0J0K5
WP_014018220.1.78327 gi|343082857|ref|YP_004772152.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]