SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|343083724|ref|YP_004773019.1| from Cyclobacterium marinum DSM 745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|343083724|ref|YP_004773019.1|
Domain Number 1 Region: 1-427
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.65e-131
Family GABA-aminotransferase-like 0.00000000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|343083724|ref|YP_004773019.1|
Sequence length 428
Comment glutamate-1-semialdehyde 2,1-aminomutase [Cyclobacterium marinum DSM 745]
Sequence
MNTSKSKQLFEKAKEFIPGGVNSPVRAFKAVGGDPLFISHAEGAYIYDVDGNEYIEAINS
WGPMVLGHNHPLVREAVIKAMEKGTSFGAPTGMEVEIAELITKMVPSVEKVRMVNSGTEA
TMSAVRLARGFTGKDKFLKFEGNYHGHGDSFLISAGSGAITMGNPDSPGVTSGTAKDTLL
APFNDLEKVKEVVEANKGEIAAIILEPVAGNMGCVLPEPGFLEGLREICDVEEIVLIFDE
VMTGFRLSPGGAQQYLGVTPDLTTMGKIIGGGMPVGAYGGKAEIMDFVSPSGPVYQAGTL
SGNPIAMSAGLTMLKYLDENPNVYTQLEKTGETLVTGLKDSLKRVGLPYTINNLGSMYTL
FFTDQKVKNFADAQTCDTGIFGKYFRGMLEKGIYLAPSQFESLFLSTALEDTHLNKILEA
NEKTLKSL
Download sequence
Identical sequences G0IUM5
WP_014019085.1.78327 gi|343083724|ref|YP_004773019.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]