SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|343083748|ref|YP_004773043.1| from Cyclobacterium marinum DSM 745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|343083748|ref|YP_004773043.1|
Domain Number 1 Region: 475-899,942-964
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.5e-100
Family Glycine dehydrogenase subunits (GDC-P) 0.000000267
Further Details:      
 
Domain Number 2 Region: 26-445
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.57e-94
Family Glycine dehydrogenase subunits (GDC-P) 0.00000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|343083748|ref|YP_004773043.1|
Sequence length 972
Comment glycine dehydrogenase [Cyclobacterium marinum DSM 745]
Sequence
MAAPKLIIFYLFMKINLASSEKFRNRHISPSENELQEMLNTIGVDSLDTLIDETIPSTIR
LKQPLQLPKPLSENLFLKSFKATIGKNQIFKSYIGLGYYDTLVPGVIQRNILENPGWYTA
YTPYQAEIAQGRLEALINFQTMVSELTGMELANASLLDEGTAAAEAMTMLYAAKARSKKK
ATTFYVDEKVFEQTKEILKTRATPIGITLKIGPLSDLDLSDPELFGILIQYPNSDGEIIN
YESLVNAAKEGHVSTAFSTDLLSLTLLKPPGEMGADVVIGSTQRFGVPMGFGGPHAAFFA
TKESFKRQIPGRIIGVSVDKSGKNAYRMALQTREQHIKRERATSNICTAQVLLAVMAGMY
AVYHGPKGLKAIASRTHGLAVMTAKWLSEIGFEQVNKAYFDTIRIKVDQVQKEKIRAFAV
SKKLNFRYDEGHILLSFDQAKTRQDVVEIFEVFAKSTNKLQPEVPEIPSQIDATIPSELE
RKSKFLEHEVFQKYHSEHEMLRYLKKLENKDLSLVHSMISLGSCTMKLNATTEMIPITWP
EIGQLHPFAPQDQAAGYYEMFQDLRNWLSEITGFSDTSLQPNSGAQGEYAGLMVIRAYHQ
SRNEDFRNVVLIPSSAHGTNPASAVMAGMKVVIVPCDEKGNIDVDAFKEKAATYKDQLSA
LMVTYPSTHGVFEEAIKEICDLVHEYGGQVYMDGANMNAQVGLTSPGLIGADVCHLNLHK
TFCIPHGGGGPGMGPICVAKHLVPFLPGNPYVKTGGTAAITPISAAPFGSSSILPIPYAY
IAMMGEEGLSKATKIAILNANYIKTRLGADFPILYTGANGRAAHEMILDCREFKAYGVEV
EDIAKRLMDYGFHAPTVSFPVPGTLMVEPTESESKDELDRFCEAMIAIRQEIREIEEGKA
DKLVNVLKNAPHTASSIISDSWDMPYSREKAAYPLPFVKENKFWPAVGRIDAAYGDRNLM
CSCIPTSDFENE
Download sequence
Identical sequences G0IVP5
gi|343083748|ref|YP_004773043.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]