SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|343084674|ref|YP_004773969.1| from Cyclobacterium marinum DSM 745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|343084674|ref|YP_004773969.1|
Domain Number 1 Region: 3-370
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.04e-83
Family GABA-aminotransferase-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|343084674|ref|YP_004773969.1|
Sequence length 376
Comment DegT/DnrJ/EryC1/StrS aminotransferase [Cyclobacterium marinum DSM 745]
Sequence
MYRIPFNKPYATGNEWNYIQDASKKGKLASDGKYTLKCQSFFEKRYGFKKTFLTHSCTQA
LEMAALLMDLKPGDEVILPSYTYVSTANAFALRGCKVVFADSCRDYPGIDTGKLAHLITD
KTKAIVAVHYGGIACDMEQLLAISQRYNLYLVEDAAAGIDGYYVSKDQSKRPLGSFGQFA
TFSFHETKNISCGEGGMLVINDSKFIAKANLVWNRGTNKKDFSSGKANKYEWQSLGSAFA
PSEINAAWLWAQLEQIESIQSVRKIKWHWHHTHLPQILEKFDLEWMAVPKHAAQNFHLFY
GLAKNLKHRDQVLNFFKRKKIMAVFHYQSLHTSPYYLSQYPRKIDLFQAEKYSECLIRFP
LYNTLDTDKLNGLLSN
Download sequence
Identical sequences G0IZS4
WP_014020033.1.78327 gi|343084674|ref|YP_004773969.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]