SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|343084766|ref|YP_004774061.1| from Cyclobacterium marinum DSM 745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|343084766|ref|YP_004774061.1|
Domain Number 1 Region: 14-347
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.66e-33
Family GABA-aminotransferase-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|343084766|ref|YP_004774061.1|
Sequence length 352
Comment class I and II aminotransferase [Cyclobacterium marinum DSM 745]
Sequence
MSHSYNTELPDRKIYCEGKSFLHFCGTSYLGMGSHPKFRQLLIDSILKYGPNHGSSRNSN
VKLQIYDTFEEHFAAEAEAEAASLLSSGFMAGQLAFNTLTPMVDLTWTAPNTHPAITSGK
PLLSGLSHKEWQQKCIAKSHELMGQRILLLSNAVNPLIPEIHDFAWTKLLSPSNKYFLLI
DDSHAFGVLGKGIYGTFSSWKKLPVELVVCGSLGKALALPAGIILGNQSILQKVRESAVY
RTSSPPAPVFLNAFIEGQDIYFQQQEVLRKNLSYMYSAIAKLDDFKMLPQYPVISFEPAA
WVDELHQKGFIVSSFPYPFQDSPPINRIILSAWHLPTDLQTLVKAVAGMGGG
Download sequence
Identical sequences G0J181
WP_014020125.1.78327 gi|343084766|ref|YP_004774061.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]