SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|372489735|ref|YP_005029300.1| from Dechlorosoma suillum PS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|372489735|ref|YP_005029300.1|
Domain Number 1 Region: 121-301,337-525
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 7.19e-79
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00014
Further Details:      
 
Domain Number 2 Region: 18-117
Classification Level Classification E-value
Superfamily Cytochrome c 6.45e-20
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|372489735|ref|YP_005029300.1|
Sequence length 532
Comment cytochrome c, mono- and diheme variants family [Dechlorosoma suillum PS]
Sequence
MKTRVQAARRPSSLAFWLLSVPLGLGALWLASRPAHAADANAPALFQQHCAACHGADRLG
GMGPALLPENLERLRKAEALKTIREGRAATQMPAFKDQLSEADIAALADYAYAPVNPKPT
WTEKDIRASRIQHVDEKTLSPRPVFKADPMNLFVVVEGGDHHVSILDGDKLEPIHRFQSR
YALHGGPKFSPDGRFVYFASRDGWLTKFDLWNLKVVAEVRAGINTRNAAVSGDGKYVMAA
NYLPQDLVLFDADLNLIKVMEAKSADGKESSRVSAVYDAAPRKSFVAAMKDMPEVWEISY
DPEAHPIYDGLVHDYQYKEGVSVPGFLNPRRTRLTDPLDDFFFDQSYSEVMGTSREGKGQ
VVNLDARRKVSELQLSGMPHLGSGITWNWQGRTVMASTNLKEGKVTVIDMKDWKPVKDIV
TRGAGFFLRSHENSRYAFVDSMMSPAKDTLQVIDKDKLEIVKELKPVPGKTLAHIEFTKD
GRYALASLWEMDGALIIYDARTLEEVKRLPMKKPVGKYNVWNKITRSEGTSH
Download sequence
Identical sequences G8QI56
gi|372489735|ref|YP_005029300.1| WP_014238139.1.43509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]