SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357398060|ref|YP_004909985.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357398060|ref|YP_004909985.1|
Domain Number 1 Region: 26-160
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.14e-27
Family MarR-like transcriptional regulators 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|357398060|ref|YP_004909985.1|
Sequence length 171
Comment Helix-turn-helix, Fis-type [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MRDSSKDIPGRGPAPGGQEDVEELAHAADRLFYAMRRSRTATAGQSAVGLSMAQLALLVP
LADDTRGEGLPVSRLAAGAEISVPTATRMLQQLEAKGVVTRRRSPHDERRVLVRLTEDGA
ARLEAMRGELRSRQFQALSHYTPGERRALAEQLHRLTDVIGGAAPGPERDR
Download sequence
Identical sequences F8JQU3
WP_014141216.1.28582 WP_014141216.1.70206 gi|386354100|ref|YP_006052346.1| gi|357398060|ref|YP_004909985.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]