SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357401006|ref|YP_004912931.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357401006|ref|YP_004912931.1|
Domain Number 1 Region: 12-99
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.5e-22
Family ArsR-like transcriptional regulators 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357401006|ref|YP_004912931.1|
Sequence length 118
Comment ArsR family transcriptional regulator [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MASSGGAEFADPPADLLQEAAAAFGLLASPARLHIVWVLAQGECDVTGLAERVGGALPAV
SQHLAKLKLAGLVRSRREGRRQVYLVDDPDVVTIVRLMVGQLADRRSGRPERLRGLGA
Download sequence
Identical sequences F8JWK4
WP_014144151.1.28582 WP_014144151.1.70206 gi|357401006|ref|YP_004912931.1| gi|386357063|ref|YP_006055309.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]