SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357409057|ref|YP_004920980.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357409057|ref|YP_004920980.1|
Domain Number 1 Region: 10-121
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000114
Family Hypothetical protein PH1932 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357409057|ref|YP_004920980.1|
Sequence length 187
Comment hypothetical protein SCAT_p1693 [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MAEQPPAQEITDAEALRAFAHPMRQKIERCLRRGPANSTALARELGESTGLVSYHLRQLA
KHGFVEEVPELAKGRERWWRTVPGDRRLPPYSRQTPQMREMLTEMHRLDLAELLDSARRF
EEARDTLGPWADAALFSRGTLRVDPGQLRAFFEEYIALLYRYSSSEREGAPEARTVLVRL
LAIPETD
Download sequence
Identical sequences F8JLX2
WP_014152138.1.28582 WP_014152138.1.70206 gi|357409057|ref|YP_004920980.1|NC_016113 gi|386351926|ref|YP_006050173.1|NC_017585 gi|386351926|ref|YP_006050173.1| gi|357409057|ref|YP_004920980.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]