SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|357407503|ref|YP_004919426.1| from Streptomyces cattleya NRRL 8057 = DSM 46488

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357407503|ref|YP_004919426.1|
Domain Number 1 Region: 50-363
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-144
Family Alpha-L-arabinofuranosidase B, N-terminal domain 0.000000000942
Further Details:      
 
Domain Number 2 Region: 372-497
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.3e-41
Family Ricin B-like 0.0000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|357407503|ref|YP_004919426.1|
Sequence length 498
Comment alpha-N-arabinofuranosidase [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence
MSNLRPWHRLRRPPLRANVLARVGAAVAIVLAGLVTGGTTAGPAQAATQGPCDIYAAGGT
PCVAAHSTTRALYGSYGGPLYQVRRASDGSTRNIGVLGTGGYADAAAQDSFCAGTTCVIT
VIYDQSGRGNNLTQAPGGGAAPGPDNLANATAAPITVGGHQAYGVYIAPGTGYRDDHTNG
IATGDQPEGMYAIFDGTHYNGGCCFDYGNAETSNTDTGNGHMEAVYFGNIKVWGYGTGNG
PWVMADQENGLFSGVHAGYNANDPSVNDRFLTAMVKGEPNQWAIRAGNAQSGGLSTFYSG
PRPDVAGYNPMHKEGAIILGIGGDNSNGATGTFYEGVMTSGYPSDATENAVQANITAAGY
TTSRTGATTGELRAVGAGKCLDVPGGSTAAGTQVQVYGCWGGANQLWTRTPSGQLTVYGG
GGQLCLDAQGQGAVPGTKVVTWPCNGQANQQWRFNADGTVTGVQSGLCLDVTGASTADGA
LAQLWTCTGHTNQQWTLG
Download sequence
Identical sequences F8JK58
gi|357407503|ref|YP_004919426.1| gi|357407503|ref|YP_004919426.1|NC_016113 gi|386353506|ref|YP_006051753.1|NC_017585 gi|386353506|ref|YP_006051753.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]