SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386855993|ref|YP_006260170.1| from Deinococcus gobiensis I-0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386855993|ref|YP_006260170.1|
Domain Number 1 Region: 135-406
Classification Level Classification E-value
Superfamily Subtilisin-like 2.49e-72
Family Subtilases 0.00000505
Further Details:      
 
Domain Number 2 Region: 54-131
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0000000000907
Family Subtilase propeptides/inhibitors 0.0046
Further Details:      
 
Domain Number 3 Region: 461-529
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000915
Family Collagen-binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386855993|ref|YP_006260170.1|
Sequence length 532
Comment Peptidase S8 and S53, subtilisin, kexin, sedolisin [Deinococcus gobiensis I-0]
Sequence
MNVRVTAATLGLTLLLAACGEQSPTAQAAPGTGLPTAAARTQAPLLGASNPDAIAGQYIV
VFSDGAMPDLAAQSAGGLIGRLGLDPQGITVQHIYAAALNGFAARLSAQNLAKLQADRRV
KYVQQDSVVRASATQSGAVWGLDRIDQRSLPLNGSYVYDTAASNVKVYIIDTGIRITHQE
FGGRATWGTNQTGDGNNTDCGGHGTHVAGTVGSSTYGVAKSVKLVAVKVLGCNGSGSNSG
IIAGINWAVSNKGSATAIANMSLGGGRDQASNDAVNTAVNKGLFIAVAAGNENQDACNVS
PASAEKALTVGATTRSDRRADPNDWGYTQAGSPLGSNYGSCVDLFAPGTGITSTLSTGDT
AVSGATWNGTSMATPHVAGAAALILAANPSYTPDQIRAALLNSATTGKLSNLGGSVDRLL
FTNPGGGTTDPAPTPNTQTYTGSVAAGQNSYQPNTTGFNYAGGTLKASLSGPAGTDFDLY
LYRYQNGAWSVVAQSDGSTSTEGVTYTAAAGTYIWGIYAYSGSGSYTLTESK
Download sequence
Identical sequences H8GXY0
WP_014684195.1.15941 gi|386855993|ref|YP_006260170.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]