SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392392068|ref|YP_006428670.1| from Desulfitobacterium dehalogenans ATCC 51507

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392392068|ref|YP_006428670.1|
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 9.81e-45
Family N-utilization substance G protein NusG, N-terminal domain 0.0000264
Further Details:      
 
Domain Number 2 Region: 119-174
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.47e-17
Family N-utilization substance G protein NusG, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392392068|ref|YP_006428670.1|
Sequence length 175
Comment transcription antitermination protein nusG [Desulfitobacterium dehalogenans ATCC 51507]
Sequence
MTKNWYVIHTYSGYENKVKTNLEKRVESMNMEDKIFRVLVPMEDEIEIKNGKKKVAKRKV
FPGYVLVEMDMTDDSWYVVRNTPGVTGFVGTGAKPIPLLDHEVQAILKQMGVEEVRTRVD
YTVGQNVRVTSGPFKDFIASVREILEDKGKLRVSVSMFGRETPVELDFAQVEKVD
Download sequence
Identical sequences I4A4J2
WP_014792372.1.27949 WP_014792372.1.96982 gi|392392068|ref|YP_006428670.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]