SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CMO124CT from Cyanidioschyzon merolae strain 10D 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CMO124CT
Domain Number 1 Region: 76-624
Classification Level Classification E-value
Superfamily SIS domain 1.86e-168
Family Phosphoglucose isomerase, PGI 0.00000000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CMO124CT
Sequence length 648
Comment pep:novel chromosome:ASM9120v1:Chr15:321014:322961:-1 gene:CMO124C transcript:CMO124CT description:""
Sequence
MSAFVVPGWPLRGGVAGSRRSRALYPHHGSAGLLRRRAFPRCTAGDVRGSYTVGRRLPSE
TPPPLPVPTDYVLISETAEWRRLVEHASEIDRLHLRELMQDVDRVRSLRAEYDGIYLDYS
RQRVTKDTIELLFALARRARLVDKIRAMQSGAHINVTERRAVLHTALRAERNASLVVDGT
DVVRDVWRVLDHVREFSERVRSGEHRGATGKPLRSVIAVGIGGSYLGPDFVHEAFRTDPE
AFEAARGRHLHFLSNVDPVDIKRCTQDLSAEETLIVIVSKSFTTAETLLNARAMREWLWS
EMGRSDEVVRLHMVACSSNVPMVEKFGIDPRNTFEFWDWVGGRYSVCSAVGALPLSIQYG
FPTFLRFLEGARSVDANFYDVASPLAGNLPVIMGLLGVWNLSFLGYKSRALHPYAEALLK
FPAHIQQVDMESNGKHVTLRGDDVDYAVGEIDFGEPGTNGQHSFFQLLHMGQTVPCDFIG
FIESQYPLCIEGEPVSNADELMANFFAQPDALAYGKTAAECRAEGRPEWLIPHLVTTGNR
PSLTLLLQRLDPYATGQLLALYEHRTAVQGFIWDINSFDQWGVELGKVLAKRVRKQLNES
RYFGRPISEEFNASTRDLMERYLRGQVGCVFNEPFDYHRDTDTGRSPL
Download sequence
Identical sequences M1V5Y8
gnl|CMER|CMO124C XP_005537531.1.94140 CMO124CT

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]