SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CMN304CT from Cyanidioschyzon merolae strain 10D 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CMN304CT
Domain Number 1 Region: 2-179,221-287
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 2.5e-73
Family Tubulin, GTPase domain 0.00000173
Further Details:      
 
Domain Number 2 Region: 289-321,353-508
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 1.14e-37
Family Tubulin, C-terminal domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CMN304CT
Sequence length 522
Comment pep:novel chromosome:ASM9120v1:Chr14:745093:746662:-1 gene:CMN304C transcript:CMN304CT description:""
Sequence
MPREVLTLQVGQCGNQIGLEFWKQLCLEHAIGPDGRLEPYAAPNVDRKDAFFYEADDRRH
VPRALLIDLEPRVIQSIKNSAYGSLFNPENYFLDIRDRGGAGNNWASGYTQGQMLDELLF
DMIDREAENAECLAGFQICHSVAGGTGSGLGSYVMEQLHDRYPKQVVQTYSILPNQSYAV
ASGERHADARDYANSGSAATGLASGGGSGAEEDDANAMFSDVVVQPYNSLLTLRRLVEFA
DMVTVLDNAALNRIASERLYVDNPTFDQTNALVSMVMAASTTTMRFPAYSHQDLRELMST
LVPLPPCHFLVASCTPLTIYTGAGANQMNAKHVDTNQIASGVDCLPQVLPVAESRIRKTS
VYDVMRRLVQPKSLMASCPLRRGSYLSLLGVLQGEIEDPSEVQRSLQRLMERENLGFTPL
TSANVQVTLARKSPYLKCTHRVRGLMLANHTGISTLLGRTIAAYDKLRRRNAFLDNYCRE
PPFASNLDEFDLARETAQQLCDVYAQLENQVATPQVSDDTRL
Download sequence
Identical sequences M1V5W4
CMN304CT XP_005537411.1.94140 gnl|CMER|CMN304C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]