SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428223694|ref|YP_007107791.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428223694|ref|YP_007107791.1|
Domain Number - Region: 20-95
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00432
Family LacY-like proton/sugar symporter 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428223694|ref|YP_007107791.1|
Sequence length 106
Comment hypothetical protein GEI7407_0234 [Geitlerinema sp. PCC 7407]
Sequence
MAKNSEDSRGLAAGLRAWLFFLLGFTILRWPIPLSILLGAIGGLAWGSLVHWWHIETIPE
VMTKAEVEQERLEKRRTQRRLQKRQPAQRRARLRLSQMFQRGSEES
Download sequence
Identical sequences K9S4Q3
gi|428223694|ref|YP_007107791.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]