SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428223825|ref|YP_007107922.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428223825|ref|YP_007107922.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily IpsF-like 1.3e-65
Family IpsF-like 0.00000417
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428223825|ref|YP_007107922.1|
Sequence length 159
Comment 2-C-methyl-D-erythritol 2,4-cyclo diphosphate synthase [Geitlerinema sp. PCC 7407]
Sequence
MQIRIGNGYDIHRLVRDRPLVLGGVTIPHELGLLGHSDADALTHAIMDAMLGALSLGDIG
HYFPPSDPKWAGADSLELLRQVNGLIRDRGWQVSNIDSVIVAERPKIKPHIDAMRDRLAA
VLEVEPDQVGIKATTNEKLGPEGREEGIAAHAVALLVRG
Download sequence
Identical sequences K9S3Y5
gi|428223825|ref|YP_007107922.1| WP_015170438.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]