SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428223952|ref|YP_007108049.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428223952|ref|YP_007108049.1|
Domain Number 1 Region: 46-218
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.45e-72
Family HD domain 0.00000171
Further Details:      
 
Domain Number 2 Region: 207-422
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.6e-65
Family RelA/SpoT domain 0.0000131
Further Details:      
 
Domain Number 3 Region: 405-477
Classification Level Classification E-value
Superfamily TGS-like 2.11e-22
Family TGS domain 0.055
Further Details:      
 
Domain Number 4 Region: 679-759
Classification Level Classification E-value
Superfamily ACT-like 0.000000000000135
Family AF1403 N-terminal domain-like 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428223952|ref|YP_007108049.1|
Sequence length 763
Comment (p)ppGpp synthetase I SpoT/RelA [Geitlerinema sp. PCC 7407]
Sequence
MNVATLTSPTDFILPDWLNECMVQVPQPDASSTDAETDKDEKESSGPSLICRAFCFAYEL
HEGQFRASGEPYIAHPVAVAGLLRDLGGSPAMIAAGFLHDVVEDTDVTADEIEERFGPEV
RQMVEGVTKLSKFNFSSKTERQAENFRRMFLAMAKDIRVIVVKLADRLHNMRTLEHLPDV
KRRRIAMETREIFAPLANRLGIGRVKWELEDLAFKYLEPDAYRQMQSLVSEKRGSREDRI
AQVTDVLRDRMAQSGIRCVDISGRPKHLYSIYQKMQRQHKEFHEIFDIAAIRIIVESNEE
CYRALAIVHDAFKPIPGRFKDYIGLPKPNRYQSLHTVVVGNMGRPLEVQIRTLEMHQIAE
YGIAAHWKYKESGHSSSKFTASDEKFTWLRQLLEWQNDLKDAQEYLDNIKDNLFDDDVYV
FTPQGDVVALARGATSVDFAYRIHTEVGNRCAGARVDGRMVTLDTPLKNGDIVEIITQKN
SHPSLDWLNFTVTSGARNRIRQWYKRSHHDENVARGRSMLEKELGKNGLEALLKSEPMAA
VAHRCNYHTVEDLLAALGYGEVTLNLVVNRIRDAVKATQTIEVASHDADTLPLPTSHRNL
KEVPASNPNHSPIIGVEGLLYHLAGCCNPVPGEAILGVVTMSSRGISIHRQGCHNVENIP
GDRLVPVSWNNSDPARSRPQTYPVNIQIEVIDRVGVLKDILSRLTDNNINVRNAQVKTFP
DQTAVIDLCIDIRDHTQLERTFTQVRKMSDVLNMRRISQAEDC
Download sequence
Identical sequences K9S307
WP_015170565.1.54702 gi|428223952|ref|YP_007108049.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]