SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428223998|ref|YP_007108095.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428223998|ref|YP_007108095.1|
Domain Number 1 Region: 1-308
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 4.32e-55
Family Aldo-keto reductases (NADP) 0.00075
Further Details:      
 
Weak hits

Sequence:  gi|428223998|ref|YP_007108095.1|
Domain Number - Region: 275-289,314-353
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000241
Family 7-Fe ferredoxin 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428223998|ref|YP_007108095.1|
Sequence length 371
Comment aldo/keto reductase [Geitlerinema sp. PCC 7407]
Sequence
MRYRRFGKTNLRLSVLSLGTMRCLASPEVAAETVGAAIAAGVNHLETAQGYGESERYLGA
ALAQRPEARSQLYVTTKVSPTPERATMERAIAVSLERLGLDYIDCLAIHGLNTPEHLAWV
TDSEGCMAAVRAAIAAGRVGHVGFSTHGPLELILAAIATEQFSFVSLHYNYFFQRNAAAI
AAAAAQDMGVFIISPADKGGQLYTPPPALEALCAPLSPLAFGYRFLLSDPRITTLSVGPA
SPEELAWPLSAMAEAGDVGAIGDRLEAQLQERLGADRCSQCFACLPCPEEIPIPEVLRLR
NLAIAYDMDRFGQYRYQMLENAGHWFPGRRGDRCTDCGDCLPRCPEQLDIPKLLRDAHDR
LQGPARRRLWG
Download sequence
Identical sequences K9S4A8
gi|428223998|ref|YP_007108095.1| WP_015170611.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]