SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428224046|ref|YP_007108143.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224046|ref|YP_007108143.1|
Domain Number 1 Region: 155-181,246-405
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.57e-22
Family Galacturonase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428224046|ref|YP_007108143.1|
Sequence length 546
Comment hypothetical protein GEI7407_0593 [Geitlerinema sp. PCC 7407]
Sequence
MKRCSGREQERKMPRRDRPQPIRGVLGLLAIAWGLGFAAPAAALQIVVNSAQDGPIQPDD
QLTLREAIALAQGSLTLDQLSPAEAAQVDGQEVPEAVVLFNLPAEATTIELLEPLPILTT
AGLTLDGTSQPDYPEEAPEEALVDLSPVVAIAPAPDAVIPYGLAIAANDVTVRGLSLYGF
RGQATETGSLPSGNILVGSPASLGVPEGAIAPPENVTIERNWLGLSPRDSSATEPQPRPA
DSLPSSFGIYVLDAQGLTIRSNYLSGHQGSAILTSRQATDSVIRGNLITRNGFAGMPDAV
RLEGQVQGLLLESNRLIDNAGSGIFLYKPDGTVRIQGNSLAGNGAQRSRAAIYLMGSGHE
VTENAIADQNGPGIVVAAYPRSDRNRLTGNTFQNLQGLSIDLVTQQQTDPTAYTQGDGPN
PLTNSFQRRNKTANFGLDAPQFVSPEFFWMRDRRAEILGTALPGAEVTFYYVEASEATVG
QYAPLSLLGPTVTADENGRFSLEIEAPDDPESSLLPSLQLSAIAHHPNYGTSEPALTIRL
RPLPSN
Download sequence
Identical sequences K9S543
gi|428224046|ref|YP_007108143.1| WP_015170659.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]