SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428224066|ref|YP_007108163.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224066|ref|YP_007108163.1|
Domain Number 1 Region: 347-499
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.85e-24
Family HD domain 0.0084
Further Details:      
 
Weak hits

Sequence:  gi|428224066|ref|YP_007108163.1|
Domain Number - Region: 197-254,366-386,486-565,644-708
Classification Level Classification E-value
Superfamily ARM repeat 0.000806
Family Clathrin adaptor core protein 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428224066|ref|YP_007108163.1|
Sequence length 722
Comment glycyl-tRNA synthetase subunit beta [Geitlerinema sp. PCC 7407]
Sequence
MATFLLEVGTEELPADFVDSALAQWRSRLPQALSEHYLHTEALELYGTPRRLAVLIKGLP
DRQPDREELVKGPSAQAAFKDGQPTKAAEGFVRSRGASVSDLEIRSTEKGDFVFLQQQIP
GRPTAEILQELALGWISALEGRRFMRWGTGDLRFPRPIRWLVALLDGAVLPLTLPNDGAT
VTSDRVSQGHRVLHPDPVTLDHADHYLDRLRKAFVEPDVDIRRQAIEAEIKLVAEKAGGV
AEISPDLLEEVTQLVEWPTAVLGTFEDEFLELPPEVITTVMVTHQRYFPIFQADPSAPGA
SLLPRFITISNGDPKKSDIIAAGNARVIRARLADGQFFYKADCGQSLEKFLPQLETVTFQ
EALGSMGDKVKRVGQIAGQIAEQLGVSAGDRALIERAALLCKADLVTQMVFEFPELQGIM
GEKYARVSGEPEAVAQAISEHYLPKGAGDRLPPSLVGQVVGLADRLDTLVSIFALGLIPS
GSSDPFALRRAATAIVNIIWGADLSINLAALLDQVVQRFSAEKGAVMKLSAEDLLGQLRS
FFLQRIQTLLQEDRHIDYDLVSAVLGEDDPEYTERALQDLLDVRDRAQFLQTIRQDGTLE
PIYEIVNRASRLAVKGDLDTVTLDPANVVDTGRFQQPSEQAFYEALGKLLPETQAAQSAR
DYRRLVTALADTAPTISNFFDGPQSVLVMDENPDIRRNRLNLLGLLRNHARVLADFGPIV
KR
Download sequence
Identical sequences K9S562
WP_015170679.1.54702 gi|428224066|ref|YP_007108163.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]