SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428224156|ref|YP_007108253.1| from Geitlerinema sp. PCC 7407

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428224156|ref|YP_007108253.1|
Domain Number 1 Region: 176-491
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.04e-113
Family Leucine aminopeptidase, C-terminal domain 0.000000354
Further Details:      
 
Domain Number 2 Region: 1-179
Classification Level Classification E-value
Superfamily Macro domain-like 3.12e-35
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428224156|ref|YP_007108253.1|
Sequence length 493
Comment leucyl aminopeptidase [Geitlerinema sp. PCC 7407]
Sequence
MDFRGINTPHSEWSGDGLAIGFFEDAVELSGDLAKLDEALSGILSELIAEAEFKGKEGSS
AATRVGSGSAIRKLMIVGLGKAEALKLDGLRRAGAIAAKLAKREKCAHVGLSLPTGDFSP
ESSAQAIVEGITLALFKDTRFKSETDDKNPDPTQVDLLGLGDEAAAAGIAKAQQVCTGVI
LARHLVAAPPNAVTAITLAETATAIAQEHGLELEILEQADCEELGMGAFLGVARASDLPP
KFIHLTYKPAGTPRRKLAIIGKGLTFDSGGLNLKGPGSGIETMKMDMGGAAATLGAAKAV
GQLKPDTEVHFIVAATENMISGRAMRPGDILTASNGKTIEVNNTDAEGRLTLADALVFAD
KLGLDAIVDLATLTGACVIALGNDVAGLWSTSDAIADQLKQAADQAGEKLWPMPMEDKYF
DGLKSPIADMKNTGPRPGGAITAALFLKQFVKDTPWAHLDIAGPVWADKEDSYTVAGATG
YGVRTLVNWVAGA
Download sequence
Identical sequences K9S5G3
gi|428224156|ref|YP_007108253.1| WP_015170769.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]